PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus

Family

M-type_MADS

Protein Properties

Length: 61aa MW: 7082.24 Da PI: 10.4603

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
C.cajan_36668	genome	IIPG	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	104.5	3.6e-33	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyeys+ C.cajan_36668 9 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSN 59 79***********************************************95 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	1.3E-42	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	34.048	1	61	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	9.03E-31	2	60	IPR002100	Transcription factor, MADS-box
CDD	cd00265	5.84E-39	2	60	No hit	No description
PRINTS	PR00404	4.6E-34	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	3.6E-28	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.6E-34	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.6E-34	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 61 aa Download sequence Send to blast
MGRGKIEIKR IENTTNRQVT FCKRRNGLLK KAYELSVLCD AEVALIVFSS RGRLYEYSNN 60 K

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	8e-22	1	60	1	60	Myocyte-specific enhancer factor 2B
1tqe_Q	8e-22	1	60	1	60	Myocyte-specific enhancer factor 2B
1tqe_R	8e-22	1	60	1	60	Myocyte-specific enhancer factor 2B
1tqe_S	8e-22	1	60	1	60	Myocyte-specific enhancer factor 2B
6c9l_A	8e-22	1	60	1	60	Myocyte-specific enhancer factor 2B
6c9l_B	8e-22	1	60	1	60	Myocyte-specific enhancer factor 2B
6c9l_C	8e-22	1	60	1	60	Myocyte-specific enhancer factor 2B
6c9l_D	8e-22	1	60	1	60	Myocyte-specific enhancer factor 2B
6c9l_E	8e-22	1	60	1	60	Myocyte-specific enhancer factor 2B
6c9l_F	8e-22	1	60	1	60	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in the development of floral organs. Acts as C-class protein in association with MADS58. Involved in the control of lodicule number (whorl 2), stamen specification (whorl 3) and floral meristem determinacy (whorl 4), but not in the regulation of carpel morphogenesis. Plays a more predominant role in controlling lodicule development and in specifying stamen identity than MADS58. {ECO:0000269\|PubMed:11828031, ECO:0000269\|PubMed:16326928, ECO:0000269\|PubMed:9869408}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	C.cajan_36668

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT091029	4e-54	BT091029.1 Soybean clone JCVI-FLGm-14D24 unknown mRNA.
GenBank	DQ371899	4e-54	DQ371899.1 Glycine max MADS domain transporter AGL11 (AGL11) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_007146364.1	6e-37	hypothetical protein PHAVU_006G034400g
Refseq	XP_018674452.1	7e-37	PREDICTED: agamous-like MADS-box protein AGL11 isoform X1
Swissprot	Q40704	4e-37	MADS3_ORYSJ; MADS-box transcription factor 3
TrEMBL	A0A426XLP8	4e-36	A0A426XLP8_ENSVE; Uncharacterized protein
STRING	OS01T0201700-01	1e-36	(Oryza sativa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF119	33	360

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G18960.1	1e-38	MIKC_MADS family protein

Publications ? help Back to Top
Kyozuka J,Shimamoto K Ectopic expression of OsMADS3, a rice ortholog of AGAMOUS, caused a homeotic transformation of lodicules to stamens in transgenic rice plants. Plant Cell Physiol., 2002. 43(1): p. 130-5 [PMID:11828031] Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764]