![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | C.cajan_32025 | ||||||||
Common Name | KK1_033974 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 173aa MW: 19795 Da PI: 9.8365 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 48.1 | 1.4e-15 | 10 | 50 | 2 | 42 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42 +i n+s r + kR++g+lKK ELS+LC++e++ ii+ss C.cajan_32025 10 FIVNNSTRRAAYRKRKKGMLKKIDELSTLCGIEACAIIYSS 50 789999*********************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 15.811 | 1 | 50 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 2.3E-17 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.8E-6 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00266 | 2.30E-23 | 3 | 85 | No hit | No description |
SuperFamily | SSF55455 | 1.44E-21 | 3 | 95 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.3E-13 | 10 | 50 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.8E-6 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 173 aa Download sequence Send to blast |
MPRSKVKLAF IVNNSTRRAA YRKRKKGMLK KIDELSTLCG IEACAIIYSS YDPEPVAWPS 60 ERGVHKVLGR LKNMSESDQN KKMVNQKSLI TKKIQKCQEQ LDKLVKENKK KEMTMFMIHC 120 LNAGTVLPDS IKFDMNNSHG LDMVANAMQW QLFKDWLNDD DETVVPPSFG DAN |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 21 | 25 | RKRKK |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. Controls central cell differentiation during female gametophyte development. Required for the expression of DEMETER and DD46, but not for the expression of FIS2 (PubMed:16798889). Probable transcription factor that may function in the maintenance of the proper function of the central cell in pollen tube attraction (Probable). {ECO:0000269|PubMed:16798889, ECO:0000305|PubMed:26462908}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | C.cajan_32025 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020237625.1 | 1e-128 | agamous-like MADS-box protein AGL80 | ||||
Swissprot | Q9FJK3 | 1e-31 | AGL80_ARATH; Agamous-like MADS-box protein AGL80 | ||||
TrEMBL | A0A151RPP1 | 1e-126 | A0A151RPP1_CAJCA; Agamous-like MADS-box protein AGL80 | ||||
STRING | GLYMA11G30640.1 | 2e-51 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF452 | 33 | 154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G48670.1 | 6e-34 | AGAMOUS-like 80 |
Publications ? help Back to Top | |||
---|---|---|---|
|