![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | C.cajan_26166 | ||||||||
Common Name | KK1_027017 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 228aa MW: 26971.1 Da PI: 9.3563 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 55.6 | 1.3e-17 | 4 | 49 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg W + Ede+l ++v+++G+++W++Ia+++ gR++k+c++rw++ C.cajan_26166 4 RGHWRPAEDEKLRELVERYGPHNWNAIAEKFR-GRSGKSCRLRWFNQ 49 899*****************************.***********996 PP | |||||||
2 | Myb_DNA-binding | 57.9 | 2.3e-18 | 56 | 100 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 r ++T+eE+e+l+ ++ +G++ W+ Iar+++ gRt++ +k++w+ C.cajan_26166 56 RSPFTEEEEERLLASHRIHGNR-WAVIARHFP-GRTDNAVKNHWHVM 100 789*******************.*********.***********975 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 18.898 | 1 | 50 | IPR017930 | Myb domain |
SMART | SM00717 | 3.8E-15 | 3 | 52 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 6.74E-30 | 4 | 97 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 2.9E-17 | 4 | 49 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 5.6E-27 | 5 | 57 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.08E-13 | 7 | 48 | No hit | No description |
PROSITE profile | PS51294 | 25.253 | 51 | 105 | IPR017930 | Myb domain |
SMART | SM00717 | 1.7E-16 | 55 | 103 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.1E-15 | 56 | 99 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.52E-12 | 58 | 101 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 2.1E-21 | 58 | 103 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 228 aa Download sequence Send to blast |
MCSRGHWRPA EDEKLRELVE RYGPHNWNAI AEKFRGRSGK SCRLRWFNQL DPRINRSPFT 60 EEEEERLLAS HRIHGNRWAV IARHFPGRTD NAVKNHWHVM MARIRRERSK IYNAKQPLFP 120 PNIETIPSFV DKYYEKYSSH HHPHNHLQFP NKFYFHHPTS ASTLPPERSQ SVEFYDFLQV 180 NTDSNKSEVT DNAKINIRDD EEVSQDAVGH KNKNNSLPFI DFLSTPAC |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 7e-32 | 4 | 103 | 7 | 106 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that confers sensitivity to abscisic acid (ABA) and salt, but tolerance to drought (PubMed:21399993). Regulates secondary cell wall (SCW) biosynthesis, especially in interfascicular and xylary fibers (PubMed:18952777, PubMed:23781226). {ECO:0000269|PubMed:18952777, ECO:0000269|PubMed:21399993, ECO:0000269|PubMed:23781226}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | C.cajan_26166 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By abscisic acid (PubMed:16463103, PubMed:21399993). Accumulates in response to salt (PubMed:21399993). Triggered by MYB46 and MYB83 in the regulation of secondary cell wall biosynthesis (PubMed:19674407, PubMed:22197883). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:19674407, ECO:0000269|PubMed:21399993, ECO:0000269|PubMed:22197883}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT092893 | 1e-130 | BT092893.1 Soybean clone JCVI-FLGm-12J9 unknown mRNA. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020231623.1 | 1e-170 | transcription factor MYB52 | ||||
Swissprot | Q6R0C4 | 8e-80 | MYB52_ARATH; Transcription factor MYB52 | ||||
TrEMBL | A0A151S8I3 | 1e-170 | A0A151S8I3_CAJCA; Transcription factor MYB44 | ||||
STRING | GLYMA09G29940.1 | 1e-134 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF230 | 34 | 243 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G17950.1 | 3e-82 | myb domain protein 52 |
Publications ? help Back to Top | |||
---|---|---|---|
|