![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | C.cajan_22344 | ||||||||
Common Name | KK1_023002 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 90aa MW: 10274.8 Da PI: 9.5459 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 35.2 | 2.9e-11 | 45 | 76 | 4 | 36 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS- CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRt 36 W+ eE+ l++ + + +G+g+Wk Iar++g ++ C.cajan_22344 45 WSDEEHRLFLVGLQIYGKGDWKNIARYIG-TKK 76 *****************************.554 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00717 | 0.0055 | 41 | 90 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 7.5E-9 | 44 | 80 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 2.92E-9 | 44 | 82 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 3.3E-7 | 44 | 80 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 5.30E-9 | 45 | 80 | No hit | No description |
PROSITE profile | PS50090 | 6.47 | 45 | 80 | IPR017877 | Myb-like domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 90 aa Download sequence Send to blast |
MQDNTDKLVV GETSNVIHAE LDIIKLLSDS NNSPVSIRRK KYVHWSDEEH RLFLVGLQIY 60 GKGDWKNIAR YIGTKKEAKC LVMPKSFSIG |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | C.cajan_22344 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
TrEMBL | A0A151T0L9 | 3e-60 | A0A151T0L9_CAJCA; Uncharacterized protein |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF19356 | 3 | 5 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G58900.1 | 2e-12 | Homeodomain-like transcriptional regulator |