PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

C.cajan_18034

Common Name

KK1_018556

Organism

Cajanus cajan

Taxonomic ID

3821

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus

Family

MYB_related

Protein Properties

Length: 57aa MW: 6380.4 Da PI: 9.7421

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
C.cajan_18034	genome	IIPG	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	43.1	9.7e-14	14	47	1	35
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgR 35 +g+WT+eEd++l +v+++G g+W++++++ g + C.cajan_18034 14 KGPWTPEEDKKLMSYVEKHGHGNWRSVPAKAG-NT 47 79*****************************9.43 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	8.4E-16	6	43	IPR009057	Homeodomain-like
SuperFamily	SSF46689	2.21E-11	8	45	IPR009057	Homeodomain-like
PROSITE profile	PS51294	12.983	9	57	IPR017930	Myb domain
Pfam	PF00249	1.8E-12	14	48	IPR001005	SANT/Myb domain
CDD	cd00167	5.26E-8	16	49	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 57 aa Download sequence Send to blast
MGRMACCEKV GLKKGPWTPE EDKKLMSYVE KHGHGNWRSV PAKAGNTTSP YLSFNLL

Functional Description ? help Back to Top
Source	Description
UniProt	Functions as a repressor of epidermal cell outgrowth and negatively regulate trichome branch formation (PubMed:18805951, PubMed:21070410). Acts as both a positive and negative regulator of cellular outgrowth. Promotes both trichome expansion and branch formation (PubMed:21070410). Coordinately with WIN1/SHN1, participates in the regulation of cuticle biosynthesis and wax accumulation in reproductive organs and trichomes. Functions in cuticle nanoridge formation in petals and stamens, and in morphogenesis of petal conical cells and trichomes (PubMed:23709630). May play a role in the regulation of cuticle formation in vegetative organs (PubMed:24169067). {ECO:0000269\|PubMed:18805951, ECO:0000269\|PubMed:21070410, ECO:0000269\|PubMed:23709630, ECO:0000269\|PubMed:24169067}.
UniProt	Involved in the control of epidermal cell morphogenesis in petals. Promotes unidirectional cell expansion once outgrowth has been initiated (PubMed:17376813). Coordinately with WIN1/SHN1, participates in the regulation of cuticle biosynthesis and wax accumulation in reproductive organs and trichomes. Functions in cuticle nanoridge formation in petals and stamens, and in morphogenesis of petal conical cells and trichomes (PubMed:23709630). Functions as a major regulator of cuticle formation in vegetative organs by regulating the cuticle biosynthesis genes CYP86A8/LCR and CER1 (PubMed:24169067). {ECO:0000269\|PubMed:17376813, ECO:0000269\|PubMed:23709630, ECO:0000269\|PubMed:24169067}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	C.cajan_18034

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020218981.1	1e-26	transcription factor MYB4-like
Refseq	XP_020219663.1	7e-26	transcription factor MYB106
Swissprot	Q9LE63	7e-20	MY106_ARATH; Transcription factor MYB106
Swissprot	Q9LXF1	4e-20	MYB16_ARATH; Transcription factor MYB16
TrEMBL	A0A151TA98	3e-35	A0A151TA98_CAJCA; Myb-related protein Myb4
TrEMBL	A0A151TAA3	7e-34	A0A151TAA3_CAJCA; Protein ODORANT1
STRING	GLYMA01G06181.1	6e-22	(Glycine max)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF31	34	817

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G15310.1	2e-22	myb domain protein 16

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Huang BH, et al. Positive selection and functional divergence of R2R3-MYB paralogous genes expressed in inflorescence buds of Scutellaria species (Labiatae). Int J Mol Sci, 2015. 16(3): p. 5900-21 [PMID:25782156] Cui F, et al. Dissecting Abscisic Acid Signaling Pathways Involved in Cuticle Formation. Mol Plant, 2016. 9(6): p. 926-38 [PMID:27060495]