![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | C.cajan_18034 | ||||||||
Common Name | KK1_018556 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 57aa MW: 6380.4 Da PI: 9.7421 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 43.1 | 9.7e-14 | 14 | 47 | 1 | 35 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgR 35 +g+WT+eEd++l +v+++G g+W++++++ g + C.cajan_18034 14 KGPWTPEEDKKLMSYVEKHGHGNWRSVPAKAG-NT 47 79*****************************9.43 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 8.4E-16 | 6 | 43 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 2.21E-11 | 8 | 45 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 12.983 | 9 | 57 | IPR017930 | Myb domain |
Pfam | PF00249 | 1.8E-12 | 14 | 48 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 5.26E-8 | 16 | 49 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 57 aa Download sequence Send to blast |
MGRMACCEKV GLKKGPWTPE EDKKLMSYVE KHGHGNWRSV PAKAGNTTSP YLSFNLL |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Functions as a repressor of epidermal cell outgrowth and negatively regulate trichome branch formation (PubMed:18805951, PubMed:21070410). Acts as both a positive and negative regulator of cellular outgrowth. Promotes both trichome expansion and branch formation (PubMed:21070410). Coordinately with WIN1/SHN1, participates in the regulation of cuticle biosynthesis and wax accumulation in reproductive organs and trichomes. Functions in cuticle nanoridge formation in petals and stamens, and in morphogenesis of petal conical cells and trichomes (PubMed:23709630). May play a role in the regulation of cuticle formation in vegetative organs (PubMed:24169067). {ECO:0000269|PubMed:18805951, ECO:0000269|PubMed:21070410, ECO:0000269|PubMed:23709630, ECO:0000269|PubMed:24169067}. | |||||
UniProt | Involved in the control of epidermal cell morphogenesis in petals. Promotes unidirectional cell expansion once outgrowth has been initiated (PubMed:17376813). Coordinately with WIN1/SHN1, participates in the regulation of cuticle biosynthesis and wax accumulation in reproductive organs and trichomes. Functions in cuticle nanoridge formation in petals and stamens, and in morphogenesis of petal conical cells and trichomes (PubMed:23709630). Functions as a major regulator of cuticle formation in vegetative organs by regulating the cuticle biosynthesis genes CYP86A8/LCR and CER1 (PubMed:24169067). {ECO:0000269|PubMed:17376813, ECO:0000269|PubMed:23709630, ECO:0000269|PubMed:24169067}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | C.cajan_18034 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020218981.1 | 1e-26 | transcription factor MYB4-like | ||||
Refseq | XP_020219663.1 | 7e-26 | transcription factor MYB106 | ||||
Swissprot | Q9LE63 | 7e-20 | MY106_ARATH; Transcription factor MYB106 | ||||
Swissprot | Q9LXF1 | 4e-20 | MYB16_ARATH; Transcription factor MYB16 | ||||
TrEMBL | A0A151TA98 | 3e-35 | A0A151TA98_CAJCA; Myb-related protein Myb4 | ||||
TrEMBL | A0A151TAA3 | 7e-34 | A0A151TAA3_CAJCA; Protein ODORANT1 | ||||
STRING | GLYMA01G06181.1 | 6e-22 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF31 | 34 | 817 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G15310.1 | 2e-22 | myb domain protein 16 |
Publications ? help Back to Top | |||
---|---|---|---|
|