![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | C.cajan_14854 | ||||||||
Common Name | KK1_015288 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 215aa MW: 24388.9 Da PI: 9.296 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 158.9 | 2e-49 | 13 | 139 | 2 | 128 |
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.k 96 ppGfrFh +deel+v+yL++k+++++l++ ++i+e+d+yk++Pw+Lp+k +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk++ls+ + C.cajan_14854 13 PPGFRFHLSDEELIVHYLQNKISSRPLPA-SIIAEIDLYKYNPWELPNKSLFGEEEWYFFSPRDRKYPNGLRPNRAAASGYWKATGTDKPILSSsG 107 9****************************.89***************8777899**************************************9977 PP NAM 97 gelvglkktLvfykgrapkgektdWvmheyrl 128 ++ +g+kk Lvfy+gr p+g+k+dW+m+eyrl C.cajan_14854 108 SKRIGVKKALVFYSGRPPNGSKADWIMNEYRL 139 888***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.1E-56 | 9 | 150 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 53.931 | 12 | 161 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.1E-24 | 13 | 139 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0016021 | Cellular Component | integral component of membrane | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 215 aa Download sequence Send to blast |
MEGDQQGSHY SFPPGFRFHL SDEELIVHYL QNKISSRPLP ASIIAEIDLY KYNPWELPNK 60 SLFGEEEWYF FSPRDRKYPN GLRPNRAAAS GYWKATGTDK PILSSSGSKR IGVKKALVFY 120 SGRPPNGSKA DWIMNEYRLI DTATSSSRLK IGSFFCLIVY FHVFHSFMII FVILCSSPVD 180 TALLQHASTS FTCLRPSSSW NSCIQAITKL IIINS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3swm_A | 1e-61 | 8 | 160 | 16 | 166 | NAC domain-containing protein 19 |
3swm_B | 1e-61 | 8 | 160 | 16 | 166 | NAC domain-containing protein 19 |
3swm_C | 1e-61 | 8 | 160 | 16 | 166 | NAC domain-containing protein 19 |
3swm_D | 1e-61 | 8 | 160 | 16 | 166 | NAC domain-containing protein 19 |
3swp_A | 1e-61 | 8 | 160 | 16 | 166 | NAC domain-containing protein 19 |
3swp_B | 1e-61 | 8 | 160 | 16 | 166 | NAC domain-containing protein 19 |
3swp_C | 1e-61 | 8 | 160 | 16 | 166 | NAC domain-containing protein 19 |
3swp_D | 1e-61 | 8 | 160 | 16 | 166 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor of the NAC family associated with male fertility. {ECO:0000250}. | |||||
UniProt | Transcription factor of the NAC family associated with male fertility. Involved in anther development, but not in senescence. Reduced expression of NAC5 via RNAi leads to male-sterility. {ECO:0000269|PubMed:22278768}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | C.cajan_14854 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Up-regulated by drought, salt and cold treatments. {ECO:0000269|PubMed:18813954}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015040 | 1e-104 | AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020224808.2 | 1e-110 | NAC transcription factor 56, partial | ||||
Swissprot | A2YMR0 | 4e-71 | NAC10_ORYSI; NAC transcription factor ONAC010 | ||||
Swissprot | Q8H4S4 | 5e-71 | NAC10_ORYSJ; NAC domain-containing protein 10 | ||||
TrEMBL | A0A151SYG9 | 1e-158 | A0A151SYG9_CAJCA; NAC domain-containing protein 29 | ||||
STRING | GLYMA13G40251.1 | 7e-99 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF2416 | 29 | 81 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G61110.1 | 2e-71 | NAC domain containing protein 25 |
Publications ? help Back to Top | |||
---|---|---|---|
|