PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | C.cajan_11897 | ||||||||
Common Name | KK1_012261 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
|
||||||||
Family | DBB | ||||||||
Protein Properties | Length: 238aa MW: 26140.9 Da PI: 5.0121 | ||||||||
Description | DBB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-B_box | 22.4 | 2.5e-07 | 4 | 44 | 5 | 39 |
zf-B_box 5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39 C+ +e+ +++ C ++ lC++C +e H H++ C.cajan_11897 4 QCDVCEKAPATVICCADEAALCAKCDVEVHAAnklaskHQR 44 7*****************************65667777765 PP | |||||||
2 | zf-B_box | 26.1 | 1.8e-08 | 53 | 85 | 2 | 34 |
zf-B_box 2 eerkCpeHeekelqlfCedCqqllCedClleeH 34 + ++C+ +++k + +fC +++ l+C++C + +H C.cajan_11897 53 KLPRCDICQDKAAFIFCVEDRALFCKECDEPIH 85 789***************************999 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50119 | 9.3 | 1 | 47 | IPR000315 | B-box-type zinc finger |
CDD | cd00021 | 1.66E-6 | 3 | 47 | No hit | No description |
SMART | SM00336 | 8.9E-10 | 4 | 47 | IPR000315 | B-box-type zinc finger |
Pfam | PF00643 | 2.0E-5 | 4 | 44 | IPR000315 | B-box-type zinc finger |
SMART | SM00336 | 2.4E-14 | 52 | 99 | IPR000315 | B-box-type zinc finger |
PROSITE profile | PS50119 | 9.086 | 52 | 99 | IPR000315 | B-box-type zinc finger |
Pfam | PF00643 | 5.7E-7 | 53 | 95 | IPR000315 | B-box-type zinc finger |
CDD | cd00021 | 8.73E-6 | 55 | 98 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009640 | Biological Process | photomorphogenesis | ||||
GO:0009651 | Biological Process | response to salt stress | ||||
GO:0048573 | Biological Process | photoperiodism, flowering | ||||
GO:0080167 | Biological Process | response to karrikin | ||||
GO:0090351 | Biological Process | seedling development | ||||
GO:1902448 | Biological Process | positive regulation of shade avoidance | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003712 | Molecular Function | transcription cofactor activity | ||||
GO:0008270 | Molecular Function | zinc ion binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 238 aa Download sequence Send to blast |
MKIQCDVCEK APATVICCAD EAALCAKCDV EVHAANKLAS KHQRLLLQCL SNKLPRCDIC 60 QDKAAFIFCV EDRALFCKEC DEPIHVAGSL SANHQRFLAT GIRVALGSKC TKSNEKGNVE 120 PSNPNAQQVP VKLPSHQVPS FTSSWVVDDL LELADFESPH KKQSLEFGEL EWLTDVGLFS 180 EQIPQEALAA AEVPQLPVTH ASSVALHKIP KSVMSFKKPR VEVLDEDDDE YFTVPDLG |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Acts as negative regulator of seedling photomorphogenesis and light-regulated inhibition of hypocotyl elongation (PubMed:17605755, PubMed:18540109, PubMed:21685177). BBX24/STO and BBX25/STH function as transcriptional corepressors of HY5 activity, leading to the down-regulation of BBX22 expression. BBX24/STO acts additively with BBX25/STH during de-etiolation and the hypocotyl shade avoidance response (PubMed:23624715). Functions as negative regulator of photomorphogenic UV-B responses by interacting with both COP1 and HY5 (PubMed:22410790). May act as a transcription factor in the salt-stress response (PubMed:12909688). {ECO:0000269|PubMed:12909688, ECO:0000269|PubMed:17605755, ECO:0000269|PubMed:18540109, ECO:0000269|PubMed:21685177, ECO:0000269|PubMed:22410790, ECO:0000269|PubMed:23624715}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | C.cajan_11897 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Circadian regulation with a peak before dawn. {ECO:0000269|PubMed:17605755}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KT031264 | 0.0 | KT031264.1 Glycine max clone HN_CCL_190 C2C2-Zn CO-like transcription factor (Glyma11g13570.1) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020216474.1 | 1e-174 | B-box zinc finger protein 24 | ||||
Swissprot | Q96288 | 2e-96 | BBX24_ARATH; B-box zinc finger protein 24 | ||||
TrEMBL | A0A151TG31 | 1e-173 | A0A151TG31_CAJCA; Salt tolerance protein | ||||
STRING | GLYMA11G13570.1 | 1e-152 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF3438 | 31 | 57 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G06040.1 | 7e-99 | DBB family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|