PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

C.cajan_08743

Organism

Cajanus cajan

Taxonomic ID

3821

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus

Family

M-type_MADS

Protein Properties

Length: 62aa MW: 7129.43 Da PI: 10.7426

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
C.cajan_08743	genome	IIPG	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	104.4	4e-33	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gklye++s C.cajan_08743 9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS 59 79***********************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	2.1E-41	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	33.179	1	61	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	4.19E-31	2	60	IPR002100	Transcription factor, MADS-box
CDD	cd00265	7.72E-39	2	59	No hit	No description
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.4E-34	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	9.6E-28	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.4E-34	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.4E-34	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 62 aa Download sequence Send to blast
MGRGKVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFSN RGKLYEFCSG 60 PR

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6byy_A	1e-20	1	59	1	59	MEF2 CHIMERA
6byy_B	1e-20	1	59	1	59	MEF2 CHIMERA
6byy_C	1e-20	1	59	1	59	MEF2 CHIMERA
6byy_D	1e-20	1	59	1	59	MEF2 CHIMERA
6bz1_A	1e-20	1	59	1	59	MEF2 CHIMERA
6bz1_B	1e-20	1	59	1	59	MEF2 CHIMERA
6bz1_C	1e-20	1	59	1	59	MEF2 CHIMERA
6bz1_D	1e-20	1	59	1	59	MEF2 CHIMERA
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor that binds specifically to the CArG box DNA sequence 5'-CC (A/T)6 GG-3' (PubMed:7632923, PubMed:25183521). Plays an important role in the determination of flower meristem identity. Involved in the specification of sepal identity. Contributes to the development of petals, stamens and carpels (PubMed:15530395). {ECO:0000269\|PubMed:15530395, ECO:0000269\|PubMed:25183521, ECO:0000269\|PubMed:7632923}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	C.cajan_08743

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AP015043	1e-81	AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_007153483.1	2e-38	hypothetical protein PHAVU_003G039400g
Swissprot	P29383	5e-35	AGL3_ARATH; Agamous-like MADS-box protein AGL3
TrEMBL	V7C5L0	4e-37	V7C5L0_PHAVU; Uncharacterized protein
STRING	XP_007153483.1	6e-38	(Phaseolus vulgaris)
STRING	Lus10017870	1e-36	(Linum usitatissimum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF119	33	360

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G03710.3	1e-39	MIKC_MADS family protein

Publications ? help Back to Top
Maejima K, et al. Degradation of class E MADS-domain transcription factors in Arabidopsis by a phytoplasmal effector, phyllogen. Plant Signal Behav, 2015. 10(8): p. e1042635 [PMID:26179462]