![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | C.cajan_08356 | ||||||||
Common Name | KK1_008603, KK1_008604 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 66aa MW: 7935.92 Da PI: 8.0735 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 59.9 | 4.9e-19 | 9 | 47 | 21 | 59 |
-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 21 prsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 rsYYrCt+ +C+vkk+ver aedp++v++tYeg+H h+ C.cajan_08356 9 CRSYYRCTQDNCRVKKRVERLAEDPRMVITTYEGRHAHS 47 7*************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF03106 | 4.3E-13 | 9 | 46 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 8.89E-15 | 9 | 48 | IPR003657 | WRKY domain |
Gene3D | G3DSA:2.20.25.80 | 2.7E-16 | 9 | 48 | IPR003657 | WRKY domain |
SMART | SM00774 | 3.1E-9 | 10 | 48 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 16.432 | 10 | 49 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 66 aa Download sequence Send to blast |
MMRVWVHACR SYYRCTQDNC RVKKRVERLA EDPRMVITTY EGRHAHSPSN ELEDSQSPSE 60 LSNFFW |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | C.cajan_08356 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015035 | 2e-68 | AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020213067.1 | 3e-35 | probable WRKY transcription factor 13 isoform X1 | ||||
Refseq | XP_020213068.1 | 3e-35 | probable WRKY transcription factor 13 isoform X2 | ||||
Swissprot | Q9SVB7 | 5e-25 | WRK13_ARATH; Probable WRKY transcription factor 13 | ||||
TrEMBL | A0A151TQU1 | 6e-43 | A0A151TQU1_CAJCA; Putative WRKY transcription factor 13 | ||||
STRING | GLYMA04G39621.1 | 2e-32 | (Glycine max) | ||||
STRING | GLYMA06G15260.1 | 2e-32 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF4079 | 33 | 61 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G39410.1 | 2e-27 | WRKY DNA-binding protein 13 |