![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | C.cajan_08024 | ||||||||
Common Name | KK1_008267 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 57aa MW: 6488.57 Da PI: 10.4332 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 35.7 | 2e-11 | 10 | 39 | 1 | 30 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIart 30 +++WT+eE++ l+ +v ++G g Wk+I + C.cajan_08024 10 KNKWTKEEEKALIAGVMKHGEGFWKKILQD 39 689************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 1.2E-12 | 4 | 55 | IPR009057 | Homeodomain-like |
PROSITE profile | PS50090 | 6.795 | 5 | 55 | IPR017877 | Myb-like domain |
SuperFamily | SSF46689 | 6.53E-11 | 8 | 55 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 1.8E-9 | 10 | 38 | IPR001005 | SANT/Myb domain |
CDD | cd11660 | 1.71E-12 | 12 | 55 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 57 aa Download sequence Send to blast |
MATSKQKIAK NKWTKEEEKA LIAGVMKHGE GFWKKILQDP EFSDVLSSRS NVNIKVI |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Binds preferentially double-stranded telomeric repeats, but may also bind to the single telomeric strand. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | C.cajan_08024 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012469639.1 | 2e-14 | PREDICTED: telomere repeat-binding factor 2-like isoform X2 | ||||
Refseq | XP_016680428.1 | 2e-14 | PREDICTED: telomere repeat-binding factor 2-like | ||||
Refseq | XP_016697329.1 | 2e-14 | PREDICTED: telomere repeat-binding factor 2-like | ||||
Refseq | XP_016706224.1 | 2e-14 | PREDICTED: telomere repeat-binding factor 2-like isoform X2 | ||||
Refseq | XP_017624388.1 | 2e-14 | PREDICTED: telomere repeat-binding factor 2-like isoform X2 | ||||
Refseq | XP_017628203.1 | 2e-14 | PREDICTED: telomere repeat-binding factor 2-like | ||||
Refseq | XP_017628204.1 | 2e-14 | PREDICTED: telomere repeat-binding factor 2-like | ||||
Refseq | XP_022775106.1 | 2e-14 | telomere repeat-binding factor 2-like isoform X2 | ||||
Swissprot | Q8W119 | 1e-14 | SMH4_MAIZE; Single myb histone 4 | ||||
TrEMBL | A0A151U8C5 | 6e-33 | A0A151U8C5_CAJCA; Uncharacterized protein |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF3228 | 29 | 58 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G17520.1 | 1e-16 | MYB_related family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|