PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Bv5_113480_aoik.t2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 82aa MW: 9388.98 Da PI: 9.8661 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 96.4 | 1.2e-30 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtfskRr g+lKKA+E+S+LCda+va+iifs++gkl+ey+s Bv5_113480_aoik.t2 9 KRIENKINRQVTFSKRRIGLLKKAHEISILCDADVALIIFSTKGKLFEYAS 59 79***********************************************86 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 31.637 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 9.2E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.02E-28 | 2 | 63 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.01E-35 | 2 | 59 | No hit | No description |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.1E-31 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.3E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.1E-31 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.1E-31 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010077 | Biological Process | maintenance of inflorescence meristem identity | ||||
GO:0010154 | Biological Process | fruit development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 82 aa Download sequence Send to blast |
MGRGRVQLKR IENKINRQVT FSKRRIGLLK KAHEISILCD ADVALIIFST KGKLFEYASD 60 TXWIVVEIGE LKIFCLLCSC LQ |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 5e-21 | 1 | 59 | 1 | 59 | MEF2C |
5f28_B | 5e-21 | 1 | 59 | 1 | 59 | MEF2C |
5f28_C | 5e-21 | 1 | 59 | 1 | 59 | MEF2C |
5f28_D | 5e-21 | 1 | 59 | 1 | 59 | MEF2C |
6byy_A | 5e-21 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
6byy_B | 5e-21 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
6byy_C | 5e-21 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
6byy_D | 5e-21 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
6bz1_A | 5e-21 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
6bz1_B | 5e-21 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
6bz1_C | 5e-21 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
6bz1_D | 5e-21 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in flower development. {ECO:0000250|UniProtKB:Q0HA25}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010678364.1 | 1e-36 | PREDICTED: truncated transcription factor CAULIFLOWER A isoform X1 | ||||
Refseq | XP_019105194.1 | 1e-36 | PREDICTED: truncated transcription factor CAULIFLOWER D isoform X2 | ||||
Swissprot | Q6E6S7 | 9e-34 | AP1_VITVI; Agamous-like MADS-box protein AP1 | ||||
TrEMBL | A0A0J8CFD5 | 3e-35 | A0A0J8CFD5_BETVU; Uncharacterized protein | ||||
STRING | XP_010678364.1 | 4e-36 | (Beta vulgaris) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G60910.1 | 3e-35 | AGAMOUS-like 8 |
Publications ? help Back to Top | |||
---|---|---|---|
|