PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta

Family

M-type_MADS

Protein Properties

Length: 108aa MW: 12479.4 Da PI: 8.9431

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Bv2_028110_zsrh.t2	genome	TBVR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	95.4	2.5e-30	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+ rqvtfskRr g+lKKA+E+SvLCdaeva+i+fs++gkl+ey+s Bv2_028110_zsrh.t2 9 KRIENKISRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYAS 59 79***********************************************86 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	1.3E-40	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	32.674	1	61	IPR002100	Transcription factor, MADS-box
CDD	cd00265	8.18E-42	2	80	No hit	No description
SuperFamily	SSF55455	1.31E-34	2	88	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.0E-32	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	8.8E-26	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.0E-32	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.0E-32	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 108 aa Download sequence Send to blast
MGRGKVELKR IENKISRQVT FSKRRSGLLK KAHEISVLCD AEVALIVFST KGKLFEYAST 60 DSSMERILER YERYCYAERQ LVATDSEGQQ EIVSHLLCHH CKLQQPFS

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	2e-24	1	85	1	83	Myocyte-specific enhancer factor 2B
1tqe_Q	2e-24	1	85	1	83	Myocyte-specific enhancer factor 2B
1tqe_R	2e-24	1	85	1	83	Myocyte-specific enhancer factor 2B
1tqe_S	2e-24	1	85	1	83	Myocyte-specific enhancer factor 2B
6byy_A	2e-24	1	85	1	83	MEF2 CHIMERA
6byy_B	2e-24	1	85	1	83	MEF2 CHIMERA
6byy_C	2e-24	1	85	1	83	MEF2 CHIMERA
6byy_D	2e-24	1	85	1	83	MEF2 CHIMERA
6c9l_A	2e-24	1	85	1	83	Myocyte-specific enhancer factor 2B
6c9l_B	2e-24	1	85	1	83	Myocyte-specific enhancer factor 2B
6c9l_C	2e-24	1	85	1	83	Myocyte-specific enhancer factor 2B
6c9l_D	2e-24	1	85	1	83	Myocyte-specific enhancer factor 2B
6c9l_E	2e-24	1	85	1	83	Myocyte-specific enhancer factor 2B
6c9l_F	2e-24	1	85	1	83	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in flower development. {ECO:0000250\|UniProtKB:Q0HA25}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_019103651.1	2e-69	PREDICTED: truncated transcription factor CAULIFLOWER A-like
Swissprot	D7SMN6	8e-49	FULL_VITVI; Agamous-like MADS-box protein FUL-L
TrEMBL	A0A0K9QKC7	1e-55	A0A0K9QKC7_SPIOL; Uncharacterized protein
STRING	XP_010666772.1	3e-58	(Beta vulgaris)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G69120.1	6e-48	MIKC_MADS family protein

Publications ? help Back to Top
Jaillon O, et al. The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla. Nature, 2007. 449(7161): p. 463-7 [PMID:17721507] Díaz-Riquelme J,Lijavetzky D,Martínez-Zapater JM,Carmona MJ Genome-wide analysis of MIKCC-type MADS box genes in grapevine. Plant Physiol., 2009. 149(1): p. 354-69 [PMID:18997115] Grimplet J,Martínez-Zapater JM,Carmona MJ Structural and functional annotation of the MADS-box transcription factor family in grapevine. BMC Genomics, 2016. 17: p. 80 [PMID:26818751]