![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Brast08G092800.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 181aa MW: 19184.3 Da PI: 8.1921 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 185.3 | 4.6e-58 | 30 | 126 | 1 | 97 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 vreqdrflPian+srimkk++Pan+ki+kdaketvqecvsefisf+tseasdkcqrekrktingddllwa+atlGfedy+eplkvyl+kyr Brast08G092800.1.p 30 VREQDRFLPIANISRIMKKAIPANGKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEDYIEPLKVYLQKYR 120 69***************************************************************************************** PP NF-YB 92 elegek 97 e+ g++ Brast08G092800.1.p 121 EVRGDS 126 ***997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 2.1E-54 | 29 | 134 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 2.95E-40 | 33 | 134 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.3E-28 | 36 | 100 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.2E-22 | 64 | 82 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 67 | 83 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.2E-22 | 83 | 101 | No hit | No description |
PRINTS | PR00615 | 1.2E-22 | 102 | 120 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 181 aa Download sequence Send to blast |
MADAPASPGG GGGGSHDSGG SPRGGGYGGV REQDRFLPIA NISRIMKKAI PANGKIAKDA 60 KETVQECVSE FISFITSEAS DKCQREKRKT INGDDLLWAM ATLGFEDYIE PLKVYLQKYR 120 EVRGDSKLTS KSGDGSVKKD TLGPHTGTSS SSAQGMGQQV AYNQGMGYMQ PQYHNGDISN 180 * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1n1j_A | 1e-49 | 29 | 121 | 1 | 93 | NF-YB |
4awl_B | 8e-50 | 29 | 121 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 8e-50 | 29 | 121 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Brast08G092800.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | FP098315 | 1e-173 | FP098315.1 Phyllostachys edulis cDNA clone: bphylf037i08, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003568278.1 | 1e-108 | nuclear transcription factor Y subunit B | ||||
Swissprot | P25209 | 1e-101 | NFYB_MAIZE; Nuclear transcription factor Y subunit B | ||||
TrEMBL | I1HIM3 | 1e-107 | I1HIM3_BRADI; Uncharacterized protein | ||||
STRING | BRADI2G22940.1 | 1e-108 | (Brachypodium distachyon) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP201 | 38 | 331 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G37060.3 | 7e-70 | nuclear factor Y, subunit B8 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Brast08G092800.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|