![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Brast07G238100.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 156aa MW: 17114.5 Da PI: 10.2544 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 56.6 | 5.6e-18 | 83 | 139 | 3 | 59 |
XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevakl 59 e++r+ r+++NRe+A rsR+RK+a++eeLe++v L N +Lkk+ +elk+eva+l Brast07G238100.1.p 83 EDRRTVRMMRNRESALRSRARKRAYVEELEKEVRRLVDDNLKLKKQCKELKQEVAAL 139 799***************************************************987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 8.7E-15 | 81 | 145 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 6.6E-15 | 83 | 139 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 11.875 | 83 | 139 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 5.1E-16 | 85 | 139 | No hit | No description |
SuperFamily | SSF57959 | 4.28E-13 | 85 | 139 | No hit | No description |
CDD | cd14707 | 1.73E-17 | 85 | 139 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 156 aa Download sequence Send to blast |
MASFRGGAQY VGTAAWMREP ESPQLSLMSG CSSLFSVSAL RDGDDLGGGA RSLPATPVSL 60 AGFAGAGDEV EMMELRRQGS GDEDRRTVRM MRNRESALRS RARKRAYVEE LEKEVRRLVD 120 DNLKLKKQCK ELKQEVAALV LPSKSSLRRT SSTQF* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor required for the transition to flowering promoted by FT. {ECO:0000269|PubMed:16099979, ECO:0000269|PubMed:16099980}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Brast07G238100.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003563257.1 | 2e-98 | ABSCISIC ACID-INSENSITIVE 5-like protein 2 | ||||
Swissprot | Q84JK2 | 3e-14 | FD_ARATH; Protein FD | ||||
TrEMBL | I1GV87 | 3e-97 | I1GV87_BRADI; Uncharacterized protein | ||||
STRING | BRADI1G29920.1 | 6e-98 | (Brachypodium distachyon) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP4017 | 30 | 72 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G35900.1 | 1e-06 | bZIP family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Brast07G238100.1.p |