PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium

Family

MYB

Protein Properties

Length: 337aa MW: 35131.7 Da PI: 9.8704

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Bradi4g08220.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	57.6	3e-18	24	69	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g+W++eEde l ++v ++G ++W++I++ ++ gR++k+c++rw + Bradi4g08220.1.p 24 KGPWSPEEDEALQRLVGRHGARNWSLISKSIP-GRSGKSCRLRWCNQ 69 79****************************.*********985 PP
2	Myb_DNA-binding	54.1	3.6e-17	78	120	3	47
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 ++T++Ede +++a++++G++ W+tIar ++ gRt++ +k++w++ Bradi4g08220.1.p 78 PFTADEDEAILRAHARFGNK-WATIARLLN-GRTDNAIKNHWNST 120 89****************.*****.*********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	26.186	19	74	IPR017930	Myb domain
SuperFamily	SSF46689	2.96E-31	21	117	IPR009057	Homeodomain-like
SMART	SM00717	4.0E-16	23	72	IPR001005	SANT/Myb domain
Pfam	PF00249	7.8E-18	24	69	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	3.2E-25	25	77	IPR009057	Homeodomain-like
CDD	cd00167	1.86E-15	26	68	No hit	No description
SMART	SM00717	7.7E-15	75	123	IPR001005	SANT/Myb domain
PROSITE profile	PS51294	20.31	76	125	IPR017930	Myb domain
CDD	cd00167	4.21E-12	78	121	No hit	No description
Pfam	PF00249	2.2E-14	78	120	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	6.0E-23	78	124	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 337 aa Download sequence Send to blast
MAAAAAACRA GGGGVGSKDA DRIKGPWSPE EDEALQRLVG RHGARNWSLI SKSIPGRSGK 60 SCRLRWCNQL SPQVEHRPFT ADEDEAILRA HARFGNKWAT IARLLNGRTD NAIKNHWNST 120 LKRKYSSMPA GGAGGAGGAD DGGDDVAARP LKRTSSDGHP GLCFSPGSPS GSDLSDSSHH 180 SLPSVMPSSS THVYRPVARA GGVVVLPTAA ATPPQPQPAS PPPAPAPATS LSLSLSLPGL 240 DPSQSHSQAP AAVLPAAPGA QAQAQVQMAF QLQPPPPAMN LAAPRPPAPF TGEFLSMMQE 300 MIRIEVRNYM SGFDTRSPAD AVHAANRMMM SMTKIE*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	2e-39	21	124	4	107	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor (PubMed:23067202, PubMed:23603962). Represses the expression of protein phosphatases 2C in response to abscisic acid (ABA). Confers resistance to abiotic stresses dependent of ABA (PubMed:18162593, PubMed:9678577). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB44 is enhanced by direct interaction between MYB44 and PYL8 (PubMed:24894996). Transcriptional activator of WRKY70 by direct binding to its promoter region, especially at 5'-TAACNG-3' and 5'-CNGTTA-3' symmetric motifs (PubMed:23067202, PubMed:23603962). Activates salicylic acid (SA)- mediated defenses and subsequent resistance to biotrophic pathogen P.syringae pv. tomato DC3000, but represses jasmonic acid (JA)-mediated defenses responses against the necrotrophic pathogen A.brassicicola (PubMed:23067202). {ECO:0000269\|PubMed:18162593, ECO:0000269\|PubMed:23067202, ECO:0000269\|PubMed:23603962, ECO:0000269\|PubMed:24894996, ECO:0000269\|PubMed:9678577}.
UniProt	Transcription factor that functions in salt stress response. Acts as negative regulator of NHX7/SOS1 and CBL4/SOS3 induction in response to salt stress (PubMed:23809151). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB73 is enhanced by direct interaction between MYB73 and PYL8 (PubMed:24894996). {ECO:0000269\|PubMed:23809151, ECO:0000269\|PubMed:24894996}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00274	DAP	Transfer from AT2G23290	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Bradi4g08220.1.p

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By drought, cold, high salinity, cadmium (CdCl(2)), salicylic acid (SA), jasmonate (JA), ethylene, gibberellic acid (GA), and ABA (PubMed:16463103, PubMed:18162593, PubMed:23067202). The induction by JA is COI1-dependent (PubMed:23067202). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:18162593, ECO:0000269\|PubMed:23067202}.
UniProt	INDUCTION: Induced by salt stress. {ECO:0000269\|PubMed:23809151}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT085714	1e-118	BT085714.2 Zea mays full-length cDNA clone ZM_BFc0050J01 mRNA, complete cds.
GenBank	EU970300	1e-118	EU970300.1 Zea mays clone 343188 sucrose responsive element binding protein mRNA, complete cds.
GenBank	HQ858706	1e-118	HQ858706.1 Zea mays clone UT1162 MYB-RELATED transcription factor mRNA, partial cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_003575562.1	0.0	transcription factor MYB44
Swissprot	O23160	7e-84	MYB73_ARATH; Transcription factor MYB73
Swissprot	Q9FDW1	4e-84	MYB44_ARATH; Transcription factor MYB44
TrEMBL	I1IIQ5	0.0	I1IIQ5_BRADI; Uncharacterized protein
STRING	BRADI4G08220.1	0.0	(Brachypodium distachyon)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP789	38	154
Representative plant	OGRP5	17	1784

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G23290.1	1e-68	myb domain protein 70

Link Out ? help Back to Top
Phytozome	Bradi4g08220.1.p
Entrez Gene	100823903

Publications ? help Back to Top
Li C,Chang PP,Ghebremariam KM,Qin L,Liang Y Overexpression of tomato SpMPK3 gene in Arabidopsis enhances the osmotic tolerance. Biochem. Biophys. Res. Commun., 2014. 443(2): p. 357-62 [PMID:24275141] Jaradat MR,Feurtado JA,Huang D,Lu Y,Cutler AJ Multiple roles of the transcription factor AtMYBR1/AtMYB44 in ABA signaling, stress responses, and leaf senescence. BMC Plant Biol., 2013. 13: p. 192 [PMID:24286353] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Li D, et al. Arabidopsis ABA receptor RCAR1/PYL9 interacts with an R2R3-type MYB transcription factor, AtMYB44. Int J Mol Sci, 2014. 15(5): p. 8473-90 [PMID:24828206] Xu DB, et al. A G-protein β subunit, AGB1, negatively regulates the ABA response and drought tolerance by down-regulating AtMPK6-related pathway in Arabidopsis. PLoS ONE, 2015. 10(1): p. e0116385 [PMID:25635681] Hieno A, et al. Possible Involvement of MYB44-Mediated Stomatal Regulation in Systemic Resistance Induced by Penicillium simplicissimum GP17-2 in Arabidopsis. Microbes Environ., 2016. 31(2): p. 154-9 [PMID:27301421] Zhao Q, et al. AtMYB44 Positively Regulates the Enhanced Elongation of Primary Roots Induced by N-3-Oxo-Hexanoyl-Homoserine Lactone in Arabidopsis thaliana. Mol. Plant Microbe Interact., 2016. 29(10): p. 774-785 [PMID:27604593] Song L, et al. A transcription factor hierarchy defines an environmental stress response network. Science, 2017. [PMID:27811239] Nguyen NH,Cheong JJ H2A.Z-containing nucleosomes are evicted to activate AtMYB44 transcription in response to salt stress. Biochem. Biophys. Res. Commun., 2018. 499(4): p. 1039-1043 [PMID:29649476] Nguyen NH,Cheong JJ AtMYB44 interacts with TOPLESS-RELATED corepressors to suppress protein phosphatase 2C gene transcription. Biochem. Biophys. Res. Commun., 2018. 507(1-4): p. 437-442 [PMID:30448055]