![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Bradi2g55797.2.p | ||||||||
Common Name | BRADI_2g55797, LOC100835709 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 184aa MW: 20686.8 Da PI: 7.6352 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 23.8 | 1.1e-07 | 23 | 67 | 3 | 45 |
SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45 +W++ Ed+ + +a + + + +W+++a++++ gR++ + +++q Bradi2g55797.2.p 23 PWSKAEDKAFENALVLCPEHapgRWERVAAHVP-GRSPREAWEHYQ 67 8*****************99*************.***988777776 PP | |||||||
2 | Myb_DNA-binding | 47.2 | 5e-15 | 116 | 160 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +W++eE++l++d+ +++G g+W+ I+r +Rt+ q+ s+ qky Bradi2g55797.2.p 116 PWSEEEHKLFLDGLEKYGRGDWRNISRFAVRTRTPTQVASHAQKY 160 7*******************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF46689 | 2.77E-11 | 20 | 69 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 0.002 | 20 | 72 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 6.6E-6 | 22 | 70 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 6.62E-6 | 23 | 61 | No hit | No description |
PROSITE profile | PS50090 | 6.667 | 23 | 70 | IPR017877 | Myb-like domain |
Pfam | PF00249 | 1.9E-6 | 23 | 66 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 18.225 | 109 | 165 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.94E-17 | 111 | 166 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 5.6E-11 | 113 | 163 | IPR001005 | SANT/Myb domain |
TIGRFAMs | TIGR01557 | 1.8E-16 | 114 | 164 | IPR006447 | Myb domain, plants |
Gene3D | G3DSA:1.10.10.60 | 2.3E-11 | 116 | 159 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 6.20E-11 | 116 | 161 | No hit | No description |
Pfam | PF00249 | 1.3E-12 | 116 | 160 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 184 aa Download sequence Send to blast |
MDSSYYCSNY QAAAAAAAPW SRPWSKAEDK AFENALVLCP EHAPGRWERV AAHVPGRSPR 60 EAWEHYQALV ADVDLIERGA VDVPACWNHD EDGDDDGTAA RRAGKARGEE RRRGIPWSEE 120 EHKLFLDGLE KYGRGDWRNI SRFAVRTRTP TQVASHAQKY FIRQANAATR DSKRKSIHDI 180 TTP* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2cjj_A | 2e-13 | 22 | 102 | 9 | 86 | RADIALIS |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00055 | PBM | Transfer from AT5G04760 | Download |
![]() |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Bradi2g55797.2.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | FP096878 | 1e-157 | FP096878.1 Phyllostachys edulis cDNA clone: bphyem104c18, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003567296.1 | 1e-133 | transcription factor DIVARICATA | ||||
Swissprot | Q8S9H7 | 3e-52 | DIV_ANTMA; Transcription factor DIVARICATA | ||||
TrEMBL | A0A0Q3IYG4 | 1e-132 | A0A0Q3IYG4_BRADI; Uncharacterized protein | ||||
STRING | BRADI2G55797.1 | 1e-103 | (Brachypodium distachyon) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2895 | 36 | 87 |
Representative plant | OGRP275 | 17 | 122 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G04760.1 | 1e-46 | MYB family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Bradi2g55797.2.p |
Entrez Gene | 100835709 |
Publications ? help Back to Top | |||
---|---|---|---|
|