PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g45117.1.p
Common NameBRADI_2g45117, LOC100837983
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 505aa    MW: 53077.9 Da    PI: 5.0553
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g45117.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS428.26.3e-131884611374
              GRAS   1 lvelLlecAeavssgdlelaqalLarlsel..aspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                       lv+lL++cA av++gd+e+a alLa  +    a ++ + + R+a +ft AL++rl+ s +  +   pp ++      e+++ ++ f+e++P+l
  Bradi2g45117.1.p  88 LVHLLMSCAGAVEAGDHEAAAALLADANASlaAVSTSSGIGRVAVHFTDALSRRLFLSPPAGATPTPPAAA----DPEHAFLYHHFYEACPYL 176
                       68************************9998756666699*****************955544444444444....579999999********* PP

              GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg.skeeleetgerLakfAeelgvpfefnvlva 183
                       kf+h+taNqaIlea++g++ vH++Df+++qGlQWpaL+qaLa Rp+gpp lRiTg+g+p++   ++el+ +g rLa++A++++v+f+f+ ++a
  Bradi2g45117.1.p 177 KFAHFTANQAILEAFHGCDSVHVVDFSLMQGLQWPALIQALALRPGGPPFLRITGIGPPSPPgGRDELRDVGLRLAELARSVRVRFSFRGVAA 269
                       **********************************************************99988****************************** PP

              GRAS 184 krledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleak 274
                       ++l+++++++L++ pgEa+aVn+vlqlhrll+++++l+   ++d+vL++v sl+Pk+++vveqeadhn++ Fl+rf+eal yysa+fdsl+a+
  Bradi2g45117.1.p 270 NTLDEVHPWMLQIAPGEAVAVNSVLQLHRLLASPADLQAqaPIDAVLDCVASLRPKIFTVVEQEADHNKPGFLDRFTEALFYYSAVFDSLDAT 362
                       **********************************999887799***********************************************999 PP

              GRAS 275 lpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpL 367
                        + +s+++++ E+ +l+rei+++v++ega+r+erhe l++Wr+rl++aG+++vpl+  a  qa++l+  ++++g++vee +g+l+lgW++r+L
  Bradi2g45117.1.p 363 SAGASSNAAMAEA-YLQREICDIVCHEGAARTERHEPLSRWRDRLGRAGLRAVPLGPGALRQARMLVGLFSGEGHSVEEAEGCLTLGWHGRTL 454
                       6666666666655.5****************************************************************************** PP

              GRAS 368 vsvSaWr 374
                       +s+SaWr
  Bradi2g45117.1.p 455 FSASAWR 461
                       ******8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098562.68762441IPR005202Transcription factor GRAS
PfamPF035142.2E-12888461IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009863Biological Processsalicylic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010187Biological Processnegative regulation of seed germination
GO:0042538Biological Processhyperosmotic salinity response
GO:2000033Biological Processregulation of seed dormancy process
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 505 aa     Download sequence    Send to blast
MAMGSFPFQW SMDPAPLSSG VDGSLLPSFL PPPPAAAVPD DGTAYYAASD MHSVPCLPEL  60
AAPFQSRDSA AAELAMRRAE EEVAGIRLVH LLMSCAGAVE AGDHEAAAAL LADANASLAA  120
VSTSSGIGRV AVHFTDALSR RLFLSPPAGA TPTPPAAADP EHAFLYHHFY EACPYLKFAH  180
FTANQAILEA FHGCDSVHVV DFSLMQGLQW PALIQALALR PGGPPFLRIT GIGPPSPPGG  240
RDELRDVGLR LAELARSVRV RFSFRGVAAN TLDEVHPWML QIAPGEAVAV NSVLQLHRLL  300
ASPADLQAQA PIDAVLDCVA SLRPKIFTVV EQEADHNKPG FLDRFTEALF YYSAVFDSLD  360
ATSAGASSNA AMAEAYLQRE ICDIVCHEGA ARTERHEPLS RWRDRLGRAG LRAVPLGPGA  420
LRQARMLVGL FSGEGHSVEE AEGCLTLGWH GRTLFSASAW RAAGDGGGGE ENIDSNNSNI  480
GGGSSGSDSN NSSCGVVGAA NMFL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A7e-58764606377Protein SCARECROW
5b3h_D7e-58764606377Protein SCARECROW
5hyz_A6e-58884614375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. Probably acts by participating in large multiprotein complexes that repress transcription of GA-inducible genes. Upon GA application, it is degraded by the proteasome, allowing the GA signaling pathway. In contrast, its overexpression prevents the GA signaling pathway and induces a dwarf phenotype. {ECO:0000250|UniProtKB:Q7G7J6}.
UniProtProbable transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. Probably acts by participating in large multiprotein complexes that repress transcription of GA-inducible genes. Upon GA application, it is degraded by the proteasome, allowing the GA signaling pathway. In contrast, its overexpression prevents the GA signaling pathway and induces a dwarf phenotype. {ECO:0000269|PubMed:10713441, ECO:0000269|PubMed:11826299, ECO:0000269|PubMed:20400938}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi2g45117.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated following GA3 but not ABA application. {ECO:0000269|PubMed:10713441}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003566939.10.0DELLA protein SLR1
SwissprotQ2TN881e-129SLR1_ORYSI; DELLA protein SLR1
SwissprotQ7G7J61e-129SLR1_ORYSJ; DELLA protein SLR1
TrEMBLI1HPW50.0I1HPW5_BRADI; Uncharacterized protein
STRINGBRADI2G45117.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP99838138
Representative plantOGRP12511550
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.11e-101GRAS family protein
Publications ? help Back to Top
  1. Ueguchi-Tanaka M, et al.
    Rice dwarf mutant d1, which is defective in the alpha subunit of the heterotrimeric G protein, affects gibberellin signal transduction.
    Proc. Natl. Acad. Sci. U.S.A., 2000. 97(21): p. 11638-43
    [PMID:11027362]
  2. Ikeda A, et al.
    The slender rice mutant, with constitutively activated gibberellin signal transduction, has enhanced capacity for abscisic acid level.
    Plant Cell Physiol., 2002. 43(9): p. 974-9
    [PMID:12354914]
  3. Itoh H,Matsuoka M,Steber CM
    A role for the ubiquitin-26S-proteasome pathway in gibberellin signaling.
    Trends Plant Sci., 2003. 8(10): p. 492-7
    [PMID:14557046]
  4. Oguchi K,Tanaka N,Komatsu S,Akao S
    Methylmalonate-semialdehyde dehydrogenase is induced in auxin-stimulated and zinc-stimulated root formation in rice.
    Plant Cell Rep., 2004. 22(11): p. 848-58
    [PMID:15045523]
  5. Day RB, et al.
    Two rice GRAS family genes responsive to N -acetylchitooligosaccharide elicitor are induced by phytoactive gibberellins: evidence for cross-talk between elicitor and gibberellin signaling in rice cells.
    Plant Mol. Biol., 2004. 54(2): p. 261-72
    [PMID:15159627]
  6. Oikawa T,Koshioka M,Kojima K,Yoshida H,Kawata M
    A role of OsGA20ox1 , encoding an isoform of gibberellin 20-oxidase, for regulation of plant stature in rice.
    Plant Mol. Biol., 2004. 55(5): p. 687-700
    [PMID:15604710]
  7. Komorisono M, et al.
    Analysis of the rice mutant dwarf and gladius leaf 1. Aberrant katanin-mediated microtubule organization causes up-regulation of gibberellin biosynthetic genes independently of gibberellin signaling.
    Plant Physiol., 2005. 138(4): p. 1982-93
    [PMID:16040652]
  8. Tanaka N, et al.
    Proteome approach to characterize the methylmalonate-semialdehyde dehydrogenase that is regulated by gibberellin.
    J. Proteome Res., 2005 Sep-Oct. 4(5): p. 1575-82
    [PMID:16212409]
  9. Itoh H, et al.
    Overexpression of a GRAS protein lacking the DELLA domain confers altered gibberellin responses in rice.
    Plant J., 2005. 44(4): p. 669-79
    [PMID:16262715]
  10. Luo A, et al.
    EUI1, encoding a putative cytochrome P450 monooxygenase, regulates internode elongation by modulating gibberellin responses in rice.
    Plant Cell Physiol., 2006. 47(2): p. 181-91
    [PMID:16306061]
  11. Tsuji H, et al.
    GAMYB controls different sets of genes and is differentially regulated by microRNA in aleurone cells and anthers.
    Plant J., 2006. 47(3): p. 427-44
    [PMID:16792694]
  12. Shimada A, et al.
    The rice SPINDLY gene functions as a negative regulator of gibberellin signaling by controlling the suppressive function of the DELLA protein, SLR1, and modulating brassinosteroid synthesis.
    Plant J., 2006. 48(3): p. 390-402
    [PMID:17052323]
  13. Ueguchi-Tanaka M,Nakajima M,Motoyuki A,Matsuoka M
    Gibberellin receptor and its role in gibberellin signaling in plants.
    Annu Rev Plant Biol, 2007. 58: p. 183-98
    [PMID:17472566]
  14. Liu T,Gu JY,Xu CJ,Gao Y,An CC
    Overproduction of OsSLRL2 alters the development of transgenic Arabidopsis plants.
    Biochem. Biophys. Res. Commun., 2007. 358(4): p. 983-9
    [PMID:17521606]
  15. Ueguchi-Tanaka M, et al.
    Molecular interactions of a soluble gibberellin receptor, GID1, with a rice DELLA protein, SLR1, and gibberellin.
    Plant Cell, 2007. 19(7): p. 2140-55
    [PMID:17644730]
  16. Eckardt NA
    GA perception and signal transduction: molecular interactions of the GA receptor GID1 with GA and the DELLA protein SLR1 in rice.
    Plant Cell, 2007. 19(7): p. 2095-7
    [PMID:17918309]
  17. Zhang Y, et al.
    Gibberellin homeostasis and plant height control by EUI and a role for gibberellin in root gravity responses in rice.
    Cell Res., 2008. 18(3): p. 412-21
    [PMID:18268540]
  18. Aleman L, et al.
    Functional analysis of cotton orthologs of GA signal transduction factors GID1 and SLR1.
    Plant Mol. Biol., 2008. 68(1-2): p. 1-16
    [PMID:18506581]
  19. Ueguchi-Tanaka M,Hirano K,Hasegawa Y,Kitano H,Matsuoka M
    Release of the repressive activity of rice DELLA protein SLR1 by gibberellin does not require SLR1 degradation in the gid2 mutant.
    Plant Cell, 2008. 20(9): p. 2437-46
    [PMID:18827181]
  20. Fukao T,Bailey-Serres J
    Submergence tolerance conferred by Sub1A is mediated by SLR1 and SLRL1 restriction of gibberellin responses in rice.
    Proc. Natl. Acad. Sci. U.S.A., 2008. 105(43): p. 16814-9
    [PMID:18936491]
  21. Asano K, et al.
    Isolation and characterization of dominant dwarf mutants, Slr1-d, in rice.
    Mol. Genet. Genomics, 2009. 281(2): p. 223-31
    [PMID:19066966]
  22. Kojima M, et al.
    Highly sensitive and high-throughput analysis of plant hormones using MS-probe modification and liquid chromatography-tandem mass spectrometry: an application for hormone profiling in Oryza sativa.
    Plant Cell Physiol., 2009. 50(7): p. 1201-14
    [PMID:19369275]
  23. Hirano K, et al.
    Characterization of the molecular mechanism underlying gibberellin perception complex formation in rice.
    Plant Cell, 2010. 22(8): p. 2680-96
    [PMID:20716699]
  24. Hayashi-Tsugane M, et al.
    A rice mutant displaying a heterochronically elongated internode carries a 100 kb deletion.
    J Genet Genomics, 2011. 38(3): p. 123-8
    [PMID:21477784]
  25. Fukumoto T, et al.
    Rare sugar D-allose suppresses gibberellin signaling through hexokinase-dependent pathway in Oryza sativa L.
    Planta, 2011. 234(6): p. 1083-95
    [PMID:21717189]
  26. Bhattacharyya J, et al.
    Native polyubiquitin promoter of rice provides increased constitutive expression in stable transgenic rice plants.
    Plant Cell Rep., 2012. 31(2): p. 271-9
    [PMID:21996937]
  27. Wu J, et al.
    Dominant and pleiotropic effects of a GAI gene in wheat results from a lack of interaction between DELLA and GID1.
    Plant Physiol., 2011. 157(4): p. 2120-30
    [PMID:22010107]
  28. De Vleesschauwer D, et al.
    Brassinosteroids antagonize gibberellin- and salicylate-mediated root immunity in rice.
    Plant Physiol., 2012. 158(4): p. 1833-46
    [PMID:22353574]
  29. Phanchaisri B,Samsang N,Yu L,Singkarat S,Anuntalabhochai S
    Expression of OsSPY and 14-3-3 genes involved in plant height variations of ion-beam-induced KDML 105 rice mutants.
    Mutat. Res., 2012. 734(1-2): p. 56-61
    [PMID:22445891]
  30. Mimura M,Nagato Y,Itoh J
    Rice PLASTOCHRON genes regulate leaf maturation downstream of the gibberellin signal transduction pathway.
    Planta, 2012. 235(5): p. 1081-9
    [PMID:22476293]
  31. Jiang X, et al.
    Gibberellin indirectly promotes chloroplast biogenesis as a means to maintain the chloroplast population of expanded cells.
    Plant J., 2012. 72(5): p. 768-80
    [PMID:23020316]
  32. Schmitz AJ,Folsom JJ,Jikamaru Y,Ronald P,Walia H
    SUB1A-mediated submergence tolerance response in rice involves differential regulation of the brassinosteroid pathway.
    New Phytol., 2013. 198(4): p. 1060-70
    [PMID:23496140]
  33. Hori K, et al.
    Hd16, a gene for casein kinase I, is involved in the control of rice flowering time by modulating the day-length response.
    Plant J., 2013. 76(1): p. 36-46
    [PMID:23789941]
  34. Sato T, et al.
    Expression and purification of a GRAS domain of SLR1, the rice DELLA protein.
    Protein Expr. Purif., 2014. 95: p. 248-58
    [PMID:24463428]
  35. Sakata T, et al.
    Reduction of gibberellin by low temperature disrupts pollen development in rice.
    Plant Physiol., 2014. 164(4): p. 2011-9
    [PMID:24569847]
  36. Wang W, et al.
    Dwarf Tiller1, a Wuschel-related homeobox transcription factor, is required for tiller growth in rice.
    PLoS Genet., 2014. 10(3): p. e1004154
    [PMID:24625559]
  37. Mimura M,Itoh J
    Genetic interaction between rice PLASTOCHRON genes and the gibberellin pathway in leaf development.
    Rice (N Y), 2014. 7(1): p. 25
    [PMID:25243048]
  38. Yano K, et al.
    Comprehensive gene expression analysis of rice aleurone cells: probing the existence of an alternative gibberellin receptor.
    Plant Physiol., 2015. 167(2): p. 531-44
    [PMID:25511432]
  39. Fan T, et al.
    Rice osa-miR171c Mediates Phase Change from Vegetative to Reproductive Development and Shoot Apical Meristem Maintenance by Repressing Four OsHAM Transcription Factors.
    PLoS ONE, 2015. 10(5): p. e0125833
    [PMID:26023934]
  40. Zhu N, et al.
    The R2R3-type MYB gene OsMYB91 has a function in coordinating plant growth and salt stress tolerance in rice.
    Plant Sci., 2015. 236: p. 146-56
    [PMID:26025528]
  41. Ye Y, et al.
    CEF1/OsMYB103L is involved in GA-mediated regulation of secondary wall biosynthesis in rice.
    Plant Mol. Biol., 2015. 89(4-5): p. 385-401
    [PMID:26350403]
  42. Zhao QC, et al.
    Generation of insect-resistant and glyphosate-tolerant rice by introduction of a T-DNA containing two Bt insecticidal genes and an EPSPS gene.
    J Zhejiang Univ Sci B, 2015. 16(10): p. 824-31
    [PMID:26465130]
  43. De Vleesschauwer D, et al.
    The DELLA Protein SLR1 Integrates and Amplifies Salicylic Acid- and Jasmonic Acid-Dependent Innate Immunity in Rice.
    Plant Physiol., 2016. 170(3): p. 1831-47
    [PMID:26829979]
  44. Yang C,Ma Y,Li J
    The rice YABBY4 gene regulates plant growth and development through modulating the gibberellin pathway.
    J. Exp. Bot., 2016. 67(18): p. 5545-5556
    [PMID:27578842]