PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Bradi2g33540.1.p | ||||||||
Common Name | BRADI_2g33540, LOC100835222 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 166aa MW: 18574.7 Da PI: 9.0254 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 95.9 | 2.8e-30 | 95 | 152 | 2 | 59 |
--SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 +Dg++WrKYG+K vk+s++pr+YYrC+ ++C vkk+ver+++dp++v++tY g Hnh Bradi2g33540.1.p 95 EDGFKWRKYGKKAVKNSPNPRNYYRCSAERCGVKKRVERDRDDPRFVVTTYDGVHNHA 152 8********************************************************6 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 1.8E-30 | 87 | 154 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 29.838 | 89 | 154 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 1.7E-26 | 90 | 154 | IPR003657 | WRKY domain |
SMART | SM00774 | 1.3E-33 | 94 | 153 | IPR003657 | WRKY domain |
Pfam | PF03106 | 8.2E-24 | 95 | 151 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 166 aa Download sequence Send to blast |
MAASLGLIPE ADLFSSAYAH GDFTSPLQEY YQHRYPSDLE YSATPPVFLP GAGDHHGGEE 60 EEEKKTRANS KKKARAIGGG RIGFRTRSEE VEILEDGFKW RKYGKKAVKN SPNPRNYYRC 120 SAERCGVKKR VERDRDDPRF VVTTYDGVHN HATPVSAAAA LRFYC* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 2e-24 | 80 | 154 | 4 | 77 | Probable WRKY transcription factor 4 |
2lex_A | 2e-24 | 80 | 154 | 4 | 77 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Bradi2g33540.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK357196 | 3e-72 | AK357196.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1048A03. | |||
GenBank | DQ840416 | 3e-72 | DQ840416.1 Hordeum vulgare subsp. vulgare WRKY transcription factor 17 (WRKY17) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010231637.1 | 1e-121 | probable WRKY transcription factor 50 | ||||
TrEMBL | I1HL63 | 1e-119 | I1HL63_BRADI; Uncharacterized protein | ||||
STRING | BRADI2G33540.1 | 1e-120 | (Brachypodium distachyon) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP441 | 37 | 206 | Representative plant | OGRP14 | 17 | 875 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26170.1 | 2e-36 | WRKY DNA-binding protein 50 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Bradi2g33540.1.p |
Entrez Gene | 100835222 |