PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera

Family

MIKC_MADS

Protein Properties

Length: 218aa MW: 24962 Da PI: 9.5606

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Bostr.7867s0353.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	87.4	7.8e-28	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien rqvtfskRr+g+lKKA+ELSvLCda+va i+fs++g+ly+++s Bostr.7867s0353.1.p 9 KRIENVASRQVTFSKRRKGLLKKAHELSVLCDAQVAAIVFSQKGRLYDFAS 59 79***********************************************86 PP
2	K-box	52.4	2.2e-18	83	156	9	82
K-box 9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqk 82 ++e+ ++l++e+a ++ie Lq R+++G+dL+s+s++eL++L q+eksl+ +Rs+K +l ++ie+l+ Bostr.7867s0353.1.p 83 QKEQYVQELKKEMAITMNKIEHLQLHCRKVMGQDLDSCSVEELKELTIQIEKSLTIVRSRKAKLNEDKIEKLKA 156 578889****************999******************************************986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	5.1E-39	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	31.132	1	61	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	1.28E-30	3	73	IPR002100	Transcription factor, MADS-box
CDD	cd00265	1.67E-39	3	70	No hit	No description
PRINTS	PR00404	2.9E-29	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	6.1E-25	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.9E-29	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.9E-29	38	59	IPR002100	Transcription factor, MADS-box
Pfam	PF01486	6.5E-17	86	161	IPR002487	Transcription factor, K-box
PROSITE profile	PS51297	11.305	88	181	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 218 aa Download sequence Send to blast
MVRGKIEIKR IENVASRQVT FSKRRKGLLK KAHELSVLCD AQVAAIVFSQ KGRLYDFASS 60 DMKKIMERYE IYRREYFGAE RLQKEQYVQE LKKEMAITMN KIEHLQLHCR KVMGQDLDSC 120 SVEELKELTI QIEKSLTIVR SRKAKLNEDK IEKLKAEIAG GKGDLKERSR LLQMFEEKPL 180 WTQPRSLESE KSAASCGCGN MNISDVETDL FIGLPGS*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	2e-19	1	72	1	72	Myocyte-specific enhancer factor 2B
1tqe_Q	2e-19	1	72	1	72	Myocyte-specific enhancer factor 2B
1tqe_R	2e-19	1	72	1	72	Myocyte-specific enhancer factor 2B
1tqe_S	2e-19	1	72	1	72	Myocyte-specific enhancer factor 2B
3mu6_A	1e-19	3	72	2	71	Myocyte-specific enhancer factor 2A
3mu6_B	1e-19	3	72	2	71	Myocyte-specific enhancer factor 2A
3mu6_C	1e-19	3	72	2	71	Myocyte-specific enhancer factor 2A
3mu6_D	1e-19	3	72	2	71	Myocyte-specific enhancer factor 2A
5f28_A	2e-19	1	72	1	72	MEF2C
5f28_B	2e-19	1	72	1	72	MEF2C
5f28_C	2e-19	1	72	1	72	MEF2C
5f28_D	2e-19	1	72	1	72	MEF2C
6c9l_A	2e-19	1	72	1	72	Myocyte-specific enhancer factor 2B
6c9l_B	2e-19	1	72	1	72	Myocyte-specific enhancer factor 2B
6c9l_C	2e-19	1	72	1	72	Myocyte-specific enhancer factor 2B
6c9l_D	2e-19	1	72	1	72	Myocyte-specific enhancer factor 2B
6c9l_E	2e-19	1	72	1	72	Myocyte-specific enhancer factor 2B
6c9l_F	2e-19	1	72	1	72	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	MADS-box transcription factor that acts with AGL42 and AGL71 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1. {ECO:0000269\|PubMed:21609362}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Bostr.7867s0353.1.p

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC189309	2e-68	AC189309.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB034C07, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010433643.1	1e-144	PREDICTED: MADS-box protein AGL71-like
Swissprot	Q9FLH5	2e-74	AGL72_ARATH; MADS-box protein AGL72
TrEMBL	A0A078ISC4	1e-125	A0A078ISC4_BRANA; BnaA08g30890D protein
STRING	Bostr.7867s0353.1.p	1e-157	(Boechera stricta)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM8805	12	35

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G51860.2	9e-79	MIKC_MADS family protein

Link Out ? help Back to Top
Phytozome	Bostr.7867s0353.1.p

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546]