PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera

Family

MYB

Protein Properties

Length: 249aa MW: 29005.6 Da PI: 9.9567

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Bostr.7128s0403.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	56.3	7.3e-18	5	50	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg W + Ede+l ++v+q+G+++W++Ia+++ gR++k+c++rw++ Bostr.7128s0403.1.p 5 RGHWRPAEDEKLRELVEQFGPHNWNAIAQKLS-GRSGKSCRLRWFNQ 50 899***************************.*********996 PP
2	Myb_DNA-binding	54.9	2e-17	57	100	1	46
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 r+++T+eE+e+l+ ++ +G++ W+ Iar ++ gRt++ +k++w+ Bostr.7128s0403.1.p 57 RNPFTEEEEEKLLASHRIHGNR-WSVIARFFP-GRTDNAVKNHWHV 100 789*****************.*****.*********96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	25.039	1	55	IPR017930	Myb domain
SMART	SM00717	9.3E-15	4	53	IPR001005	SANT/Myb domain
Pfam	PF00249	7.6E-17	5	50	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	3.48E-30	5	98	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	2.4E-27	6	58	IPR009057	Homeodomain-like
CDD	cd00167	3.71E-13	8	49	No hit	No description
PROSITE profile	PS51294	18.591	56	106	IPR017930	Myb domain
SMART	SM00717	5.4E-16	56	104	IPR001005	SANT/Myb domain
Pfam	PF00249	1.6E-14	57	99	IPR001005	SANT/Myb domain
CDD	cd00167	3.62E-12	59	99	No hit	No description
Gene3D	G3DSA:1.10.10.60	5.3E-21	59	104	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009737	Biological Process	response to abscisic acid
GO:2000652	Biological Process	regulation of secondary cell wall biogenesis
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 249 aa Download sequence Send to blast
MMCSRGHWRP AEDEKLRELV EQFGPHNWNA IAQKLSGRSG KSCRLRWFNQ LDPRINRNPF 60 TEEEEEKLLA SHRIHGNRWS VIARFFPGRT DNAVKNHWHV IMARRGRERS KLRPRGLGHD 120 GTTAATRMMG YNDCDKERRL ATTTAINFPY QFSHINHFQV LKEFLTGKIG FRKSTSPIKE 180 GAIDQTKRPK EFYNFLQVNT DSKKPEVIDN SRRDEEEDVD QNNRIRNENC VPFFDFLSIG 240 NSASQDLC*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	5e-31	5	105	7	107	B-MYB
1mse_C	5e-31	2	105	1	104	C-Myb DNA-Binding Domain
1msf_C	5e-31	2	105	1	104	C-Myb DNA-Binding Domain
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that confers sensitivity to abscisic acid (ABA) and salt, but tolerance to drought (PubMed:21399993). Regulates secondary cell wall (SCW) biosynthesis, especially in interfascicular and xylary fibers (PubMed:18952777, PubMed:23781226). {ECO:0000269\|PubMed:18952777, ECO:0000269\|PubMed:21399993, ECO:0000269\|PubMed:23781226}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00145	DAP	Transfer from AT1G17950	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Bostr.7128s0403.1.p

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By abscisic acid (PubMed:16463103, PubMed:21399993). Accumulates in response to salt (PubMed:21399993). Triggered by MYB46 and MYB83 in the regulation of secondary cell wall biosynthesis (PubMed:19674407, PubMed:22197883). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:19674407, ECO:0000269\|PubMed:21399993, ECO:0000269\|PubMed:22197883}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AY519554	0.0	AY519554.1 Arabidopsis thaliana MYB transcription factor (At1g17950) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_173237.1	1e-174	myb domain protein 52
Swissprot	Q6R0C4	1e-175	MYB52_ARATH; Transcription factor MYB52
TrEMBL	A0A178WDN0	1e-174	A0A178WDN0_ARATH; MYB52
STRING	Bostr.7128s0403.1.p	0.0	(Boechera stricta)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM2818	27	69

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G17950.1	1e-177	myb domain protein 52

Link Out ? help Back to Top
Phytozome	Bostr.7128s0403.1.p

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Cassan-Wang H, et al. Identification of novel transcription factors regulating secondary cell wall formation in Arabidopsis. Front Plant Sci, 2013. 4: p. 189 [PMID:23781226] Shi D, et al. MYB52 Negatively Regulates Pectin Demethylesterification in Seed Coat Mucilage. Plant Physiol., 2018. 176(4): p. 2737-2749 [PMID:29440562]