PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.3288s0111.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family ZF-HD
Protein Properties Length: 102aa    MW: 11039.3 Da    PI: 8.6114
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.3288s0111.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer1071.1e-333591360
          ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
                         ++rY eC+kNhAa++Gg+avDGC+Efm++ g egt++al+CaACgCHRnFHR+ev++e
  Bostr.3288s0111.1.p 35 NIRYVECQKNHAANIGGYAVDGCREFMAA-GVEGTVDALRCAACGCHRNFHRKEVDTE 91
                         78**************************9.999*********************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257743.0E-361100IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047709.3E-303688IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015667.3E-283788IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.3623887IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0009733Biological Processresponse to auxin
GO:0009735Biological Processresponse to cytokinin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009741Biological Processresponse to brassinosteroid
GO:0043392Biological Processnegative regulation of DNA binding
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048509Biological Processregulation of meristem development
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 102 aa     Download sequence    Send to blast
MKKRQMVIKQ KSRNSNTSSS WTTTSSSSSS SAISNIRYVE CQKNHAANIG GYAVDGCREF  60
MAAGVEGTVD ALRCAACGCH RNFHRKEVDT EVVCEYSPPN T*
Functional Description ? help Back to Top
Source Description
UniProtInhibits zinc finger homeodomain (ZHD) transcription factors, such as ZHD5, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by preventing the expression of genes involved in gibberellic acid (GA), auxin and brassinosteroid signaling and by promoting the expression of abscisic acid (ABA)-responsive genes. Regulates several development aspects, including photomorphogenesis, apical dominance, longevity, flower morphology and fertility, as well as root and stem elongation. Promotes the formation of ectopic shoot meristems on leaf margins. {ECO:0000269|PubMed:16412086, ECO:0000269|PubMed:21059647, ECO:0000269|PubMed:21455630}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBostr.3288s0111.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0117651e-140AC011765.6 Arabidopsis thaliana chromosome 1 BAC F1M20 genomic sequence, complete sequence.
GenBankAY0853271e-140AY085327.1 Arabidopsis thaliana clone 14583 mRNA, complete sequence.
GenBankBT0248061e-140BT024806.1 Arabidopsis thaliana At1g74660 gene, complete cds.
GenBankCP0026841e-140CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010416323.12e-69PREDICTED: mini zinc finger protein 1
RefseqXP_010471556.12e-69PREDICTED: mini zinc finger protein 1
SwissprotQ9CA511e-53MIF1_ARATH; Mini zinc finger protein 1
TrEMBLR0GJ862e-51R0GJ86_9BRAS; Uncharacterized protein
STRINGBostr.3288s0111.1.p4e-70(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM94428114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74660.12e-49mini zinc finger 1