![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Bostr.29827s0125.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 113aa MW: 12513.8 Da PI: 10.5882 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 59.6 | 4e-19 | 17 | 51 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 C C+ttkTp+WR gp g+k+LCnaCG+++rk+++ Bostr.29827s0125.1.p 17 CNDCKTTKTPMWRGGPTGPKSLCNACGIRFRKQRR 51 99******************************985 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50114 | 12.387 | 11 | 69 | IPR000679 | Zinc finger, GATA-type |
SMART | SM00401 | 1.4E-15 | 11 | 62 | IPR000679 | Zinc finger, GATA-type |
SuperFamily | SSF57716 | 2.42E-13 | 13 | 52 | No hit | No description |
Gene3D | G3DSA:3.30.50.10 | 1.4E-15 | 15 | 51 | IPR013088 | Zinc finger, NHR/GATA-type |
CDD | cd00202 | 1.58E-10 | 17 | 51 | No hit | No description |
Pfam | PF00320 | 4.0E-17 | 17 | 51 | IPR000679 | Zinc finger, GATA-type |
PROSITE pattern | PS00344 | 0 | 17 | 42 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009416 | Biological Process | response to light stimulus | ||||
GO:0048527 | Biological Process | lateral root development | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 113 aa Download sequence Send to blast |
MDARKLMEEE KVTVRCCNDC KTTKTPMWRG GPTGPKSLCN ACGIRFRKQR RSELLGIRIS 60 HSHKVLDSKK INPKSSSLLS HVGVAVKKRR SLKEEEQAAL CLLLLSCSSV FA* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Bostr.29827s0125.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006289523.1 | 2e-52 | GATA transcription factor 23 | ||||
Swissprot | Q8LC59 | 1e-44 | GAT23_ARATH; GATA transcription factor 23 | ||||
TrEMBL | R0FJX9 | 4e-51 | R0FJX9_9BRAS; Uncharacterized protein | ||||
STRING | Bostr.29827s0125.1.p | 4e-76 | (Boechera stricta) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM14484 | 16 | 22 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26930.1 | 5e-47 | GATA transcription factor 23 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Bostr.29827s0125.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|