![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Bostr.25463s0328.2.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 231aa MW: 26167.6 Da PI: 9.7534 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 99.2 | 1.7e-31 | 9 | 58 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fs++g+lyey+ Bostr.25463s0328.2.p 9 KRIENSTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYA 58 79***********************************************8 PP | |||||||
2 | K-box | 104.7 | 1.1e-34 | 77 | 173 | 4 | 100 |
K-box 4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenk 92 ++++ ++e +a+++qqe+akL+++i+++q+++R+l+G++L+sLs+keL+q+e++Lek++++iRskK+elll++ie+ qk+e el++en Bostr.25463s0328.2.p 77 TNTSTVQEINAAYYQQESAKLRQQIQTIQNSNRNLMGDSLSSLSVKELKQVENRLEKAISRIRSKKHELLLAEIENAQKREIELDNENI 165 34445999********************************************************************************* PP K-box 93 aLrkklee 100 +Lr+k++e Bostr.25463s0328.2.p 166 YLRTKVAE 173 *****986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 7.0E-42 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 34.034 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 5.89E-33 | 2 | 82 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 8.69E-43 | 2 | 76 | No hit | No description |
PRINTS | PR00404 | 5.9E-33 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.4E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.9E-33 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.9E-33 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 1.8E-25 | 85 | 171 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 14.503 | 87 | 177 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0048481 | Biological Process | plant ovule development | ||||
GO:0080155 | Biological Process | regulation of double fertilization forming a zygote and endosperm | ||||
GO:0090376 | Biological Process | seed trichome differentiation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 231 aa Download sequence Send to blast |
MGRGKIEIKR IENSTNRQVT FCKRRNGLLK KAYELSVLCD AEVALIVFST RGRLYEYANN 60 NIRSTIERYK KACSDSTNTS TVQEINAAYY QQESAKLRQQ IQTIQNSNRN LMGDSLSSLS 120 VKELKQVENR LEKAISRIRS KKHELLLAEI ENAQKREIEL DNENIYLRTK VAEVERFQQH 180 HHQMVSGSEI NAIEALASRN YFAHSIMTVG SGSGNGGSYS DPDKKILHLG * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 2e-21 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 2e-21 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_R | 2e-21 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_S | 2e-21 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
5f28_A | 2e-21 | 1 | 86 | 1 | 89 | MEF2C |
5f28_B | 2e-21 | 1 | 86 | 1 | 89 | MEF2C |
5f28_C | 2e-21 | 1 | 86 | 1 | 89 | MEF2C |
5f28_D | 2e-21 | 1 | 86 | 1 | 89 | MEF2C |
6c9l_A | 2e-21 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_B | 2e-21 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_C | 2e-21 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_D | 2e-21 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_E | 2e-21 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_F | 2e-21 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor (Probable). Is required, together with TT16/AGL32 for the maternal control of endothelium formation, which is essential for female gametophyte development and fertilization, and seed formation (PubMed:22176531). {ECO:0000269|PubMed:22176531, ECO:0000305}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Bostr.25463s0328.2.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU551767 | 0.0 | EU551767.1 Capsella bursa-pastoris SEEDSTICK-like protein (STKb) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001329611.1 | 1e-166 | K-box region and MADS-box transcription factor family protein | ||||
Refseq | NP_192734.1 | 1e-166 | K-box region and MADS-box transcription factor family protein | ||||
Swissprot | Q38836 | 1e-167 | AGL11_ARATH; Agamous-like MADS-box protein AGL11 | ||||
TrEMBL | A0A178UX25 | 1e-165 | A0A178UX25_ARATH; STK | ||||
TrEMBL | A0A1P8B889 | 1e-165 | A0A1P8B889_ARATH; K-box region and MADS-box transcription factor family protein | ||||
STRING | Bostr.25463s0328.1.p | 1e-168 | (Boechera stricta) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G09960.1 | 1e-159 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Bostr.25463s0328.2.p |
Publications ? help Back to Top | |||
---|---|---|---|
|