PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera

Family

bZIP

Protein Properties

Length: 163aa MW: 18927.1 Da PI: 7.197

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Bostr.17775s0009.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	44.5	3.3e-14	71	120	5	54
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 +++rrk++NRe+ArrsR RK+ +++eL v L +eN++L +l++ + Bostr.17775s0009.1.p 71 RKQRRKISNRESARRSRMRKQRQVDELWSQVMWLRNENHQLLHKLNHVLE 120 689***************************************99998655 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	4.4E-13	67	131	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	10.737	69	132	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	2.5E-12	71	121	No hit	No description
Gene3D	G3DSA:1.20.5.170	5.9E-11	71	144	No hit	No description
Pfam	PF00170	3.4E-12	71	121	IPR004827	Basic-leucine zipper domain
CDD	cd14702	1.56E-17	72	122	No hit	No description
PROSITE pattern	PS00036	0	74	89	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 163 aa Download sequence Send to blast
MQPSMNIFSL HGCPPSYLSH FPTSTPFCVN GQNPNPFYSF QTGVNSTQFM SLSNSTSDEA 60 EENHSDIINE RKQRRKISNR ESARRSRMRK QRQVDELWSQ VMWLRNENHQ LLHKLNHVLE 120 SHEKVIEENA QLKGETSELK NMISDMQLQN QSPFSCFRDD VV*

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	83	90	RRSRMRKQ

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269\|PubMed:26973252}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00533	DAP	Transfer from AT5G38800	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Bostr.17775s0009.1.p

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB009048	1e-144	AB009048.1 Arabidopsis thaliana genomic DNA, chromosome 5, TAC clone:K15E6.
GenBank	CP002688	1e-144	CP002688.1 Arabidopsis thaliana chromosome 5 sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010496567.1	1e-107	PREDICTED: basic leucine zipper 43
Swissprot	Q9FMC2	9e-98	BZP43_ARATH; Basic leucine zipper 43
TrEMBL	R0H248	1e-100	R0H248_9BRAS; Uncharacterized protein
STRING	Bostr.17775s0009.1.p	1e-118	(Boechera stricta)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM3112	26	67

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G38800.1	1e-100	basic leucine-zipper 43

Link Out ? help Back to Top
Phytozome	Bostr.17775s0009.1.p

Publications ? help Back to Top
Nowak K,Gaj MD Stress-related function of bHLH109 in somatic embryo induction in Arabidopsis. J. Plant Physiol., 2016. 193: p. 119-26 [PMID:26973252] Ezer D, et al. The G-Box Transcriptional Regulatory Code in Arabidopsis. Plant Physiol., 2017. 175(2): p. 628-640 [PMID:28864470]