![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Bostr.15697s0422.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 155aa MW: 18016.7 Da PI: 9.818 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 77.7 | 8.6e-25 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+ie+k +rqvtf+kRr+ ++KKA+ELSvLCd+ +iifs ++kly+++s Bostr.15697s0422.1.p 9 KKIEDKLRRQVTFAKRRKSLIKKAHELSVLCDVHLGLIIFSYSNKLYDFCS 59 68***********************************************96 PP | |||||||
2 | K-box | 16.7 | 3.1e-07 | 98 | 146 | 19 | 72 |
K-box 19 qelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnel 72 + + + +eienL+ ++ + G +L+ L++ eL+ Le+sl++ R++K++ Bostr.15697s0422.1.p 98 KTKESMMREIENLKLNLQLYDGHGLNLLTYDELH-----LESSLQHARARKQQQ 146 56678999*************************5.....899999999999985 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 26.38 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 2.9E-30 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 6.82E-36 | 2 | 80 | No hit | No description |
SuperFamily | SSF55455 | 4.32E-26 | 3 | 76 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.5E-23 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 7.7E-22 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.5E-23 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.5E-23 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0030308 | Biological Process | negative regulation of cell growth | ||||
GO:0048510 | Biological Process | regulation of timing of transition from vegetative to reproductive phase | ||||
GO:0048530 | Biological Process | fruit morphogenesis | ||||
GO:0080060 | Biological Process | integument development | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 155 aa Download sequence Send to blast |
MRKGKIVIKK IEDKLRRQVT FAKRRKSLIK KAHELSVLCD VHLGLIIFSY SNKLYDFCSN 60 STSMENLIMR YQMEKEGHAT PTADHSFHPD HCSSNCVKTK ESMMREIENL KLNLQLYDGH 120 GLNLLTYDEL HLESSLQHAR ARKQQQQQQT NKQT* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 5e-17 | 1 | 82 | 1 | 80 | MEF2 CHIMERA |
6byy_B | 5e-17 | 1 | 82 | 1 | 80 | MEF2 CHIMERA |
6byy_C | 5e-17 | 1 | 82 | 1 | 80 | MEF2 CHIMERA |
6byy_D | 5e-17 | 1 | 82 | 1 | 80 | MEF2 CHIMERA |
6bz1_A | 6e-17 | 1 | 82 | 1 | 80 | MEF2 CHIMERA |
6bz1_B | 6e-17 | 1 | 82 | 1 | 80 | MEF2 CHIMERA |
6bz1_C | 6e-17 | 1 | 82 | 1 | 80 | MEF2 CHIMERA |
6bz1_D | 6e-17 | 1 | 82 | 1 | 80 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in the regulation of fruit growth. Contributes to integument development. Controls organ size via cell expansion (PubMed:20088901). Involved in the regulation of longitudinal growth of the fruit evenly throughout the radial axis (PubMed:20598091). Functions redundantly with TT16/AGL32 to repress nucellus growth and promote its degeneration (PubMed:27233529). {ECO:0000269|PubMed:20088901, ECO:0000269|PubMed:20598091, ECO:0000269|PubMed:27233529}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00172 | DAP | Transfer from AT1G31140 | Download |
![]() |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Bostr.15697s0422.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB493489 | 1e-135 | AB493489.1 Arabidopsis thaliana At1g31140 mRNA for hypothetical protein, partial cds, clone: RAAt1g31140. | |||
GenBank | FR671367 | 1e-135 | FR671367.1 Arabidopsis thaliana mRNA for putative MADS domain protein AGL63 (GOA), ecotype Col-0. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006306362.2 | 2e-85 | agamous-like MADS-box protein AGL63 | ||||
Swissprot | Q9SA07 | 4e-83 | AGL63_ARATH; Agamous-like MADS-box protein AGL63 | ||||
TrEMBL | A0A2H4FR43 | 5e-84 | A0A2H4FR43_9BRAS; MADS-box transcription factor AGL63 | ||||
STRING | Bostr.15697s0422.1.p | 1e-111 | (Boechera stricta) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM16860 | 9 | 10 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G31140.2 | 3e-79 | GORDITA |
Link Out ? help Back to Top | |
---|---|
Phytozome | Bostr.15697s0422.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|