![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Bostr.13208s0037.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 156aa MW: 17549.6 Da PI: 7.6638 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 168.2 | 1e-52 | 45 | 140 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkky 90 +eqdr+lPianv+rimk++lP nakisk+ak t+qecvsefisfvt+easdkc++ekrkt+ngdd++wa+a+lGf+dy+ +lk+yl++y Bostr.13208s0037.1.p 45 KEQDRLLPIANVGRIMKNILPPNAKISKEAKVTMQECVSEFISFVTGEASDKCHKEKRKTVNGDDICWAMANLGFDDYAGQLKKYLHRY 133 89*************************************************************************************** PP NF-YB 91 relegek 97 r +egek Bostr.13208s0037.1.p 134 RITEGEK 140 ****997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 3.6E-52 | 38 | 150 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.86E-39 | 47 | 150 | IPR009072 | Histone-fold |
Pfam | PF00808 | 7.5E-28 | 50 | 114 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 9.6E-18 | 78 | 96 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 81 | 97 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 9.6E-18 | 97 | 115 | No hit | No description |
PRINTS | PR00615 | 9.6E-18 | 116 | 134 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 156 aa Download sequence Send to blast |
MAGDYPSFQN PIPRYQNYNF ASSSSHHQHH GLVVEDQQQE ENMIKEQDRL LPIANVGRIM 60 KNILPPNAKI SKEAKVTMQE CVSEFISFVT GEASDKCHKE KRKTVNGDDI CWAMANLGFD 120 DYAGQLKKYL HRYRITEGEK ANHHGKGGSK SSPDN* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 7e-43 | 44 | 134 | 1 | 91 | Transcription factor HapC (Eurofung) |
4g92_B | 7e-43 | 44 | 134 | 1 | 91 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Bostr.13208s0037.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC005309 | 1e-154 | AC005309.3 Arabidopsis thaliana chromosome 2 clone F17A22 map CIC06C03, complete sequence. | |||
GenBank | BT003968 | 1e-154 | BT003968.1 Arabidopsis thaliana clone RAFL15-27-K05 (R20859) putative CCAAT-box binding trancription factor (At2g47810) mRNA, complete cds. | |||
GenBank | BT005081 | 1e-154 | BT005081.1 Arabidopsis thaliana clone U20859 putative CCAAT-box binding trancription factor (At2g47810) mRNA, complete cds. | |||
GenBank | CP002685 | 1e-154 | CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018474925.1 | 1e-101 | PREDICTED: nuclear transcription factor Y subunit B-5 | ||||
Swissprot | O82248 | 9e-99 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | A0A1J3F499 | 1e-99 | A0A1J3F499_NOCCA; Nuclear transcription factor Y subunit B-5 | ||||
STRING | Bostr.13208s0037.1.p | 1e-115 | (Boechera stricta) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM255 | 28 | 229 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 1e-101 | nuclear factor Y, subunit B5 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Bostr.13208s0037.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|