PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera

Family

ZF-HD

Protein Properties

Length: 101aa MW: 10722.9 Da PI: 7.7389

Description

ZF-HD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Bostr.0556s0540.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	ZF-HD_dimer	107.1	9.9e-34	30	87	3	60
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 +vrY eC+kNhAa++Gg+avDGC+Efm s+geegt aal+CaACgCHR+FHRre e+e Bostr.0556s0540.1.p 30 TVRYGECQKNHAAAVGGYAVDGCREFMGSQGEEGTLAALTCAACGCHRSFHRREIETE 87 79****************************************************9876 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD125774	4.0E-30	1	97	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Pfam	PF04770	4.4E-29	31	84	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMs	TIGR01566	8.7E-28	32	84	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profile	PS51523	24.695	33	83	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain

Sequence ? help Back to Top
Protein Sequence Length: 101 aa Download sequence Send to blast
MRKRQVVLRR ASPEEPSNSS STASSLTVRT VRYGECQKNH AAAVGGYAVD GCREFMGSQG 60 EEGTLAALTC AACGCHRSFH RREIETEVVC DCNSPPSTGN *

Functional Description ? help Back to Top
Source	Description
UniProt	Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269\|PubMed:21455630}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Bostr.0556s0540.1.p

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK221094	1e-107	AK221094.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL22-84-D24.
GenBank	AP000386	1e-107	AP000386.1 Arabidopsis thaliana genomic DNA, chromosome 3, P1 clone:MLD15.
GenBank	BT024663	1e-107	BT024663.1 Arabidopsis thaliana unknown protein (At3g28917) mRNA, complete cds.
GenBank	CP002686	1e-107	CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018481496.1	3e-58	PREDICTED: mini zinc finger protein 2-like
Refseq	XP_018481497.1	3e-58	PREDICTED: mini zinc finger protein 2-like
Swissprot	Q9LJW5	5e-56	MIF2_ARATH; Mini zinc finger protein 2
TrEMBL	D7LM58	4e-54	D7LM58_ARALL; Uncharacterized protein
STRING	Bostr.0556s0540.1.p	6e-68	(Boechera stricta)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM944	28	114

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G28917.1	7e-44	mini zinc finger 2

Link Out ? help Back to Top
Phytozome	Bostr.0556s0540.1.p

Publications ? help Back to Top
Bollier N, et al. At-MINI ZINC FINGER2 and Sl-INHIBITOR OF MERISTEM ACTIVITY, a Conserved Missing Link in the Regulation of Floral Meristem Termination in Arabidopsis and Tomato. Plant Cell, 2018. 30(1): p. 83-100 [PMID:29298836]