 |
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
BGIOSGA032878-PA |
Common Name | BHLH173, ILI7, OsI_33503 |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
|
Family |
bHLH |
Protein Properties |
Length: 91aa MW: 9964.33 Da PI: 8.5297 |
Description |
bHLH family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
BGIOSGA032878-PA | genome | RIS | View CDS |
|
Signature Domain? help Back to Top |
 |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | HLH | 19 | 2.6e-06 | 20 | 58 | 16 | 54 |
HHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
HLH 16 iNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
i + ++L+ llP+a ++ ++ a +L++++ YI+sL
BGIOSGA032878-PA 20 IGDLVSKLQALLPEARLRSNDRVPSARVLQETCSYIRSL 58
5667799*******8899*******************99 PP
|
Gene Ontology ? help Back to Top |
GO Term |
GO Category |
GO Description |
GO:0006355 | Biological Process | regulation of transcription, DNA-templated |
GO:0040008 | Biological Process | regulation of growth |
GO:0046983 | Molecular Function | protein dimerization activity |
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Atypical and probable non DNA-binding bHLH transcription factor that integrates multiple signaling pathways to regulate cell elongation and plant development. {ECO:0000250}. |
Annotation --
Nucleotide ? help
Back to Top |
Source |
Hit ID |
E-value |
Description |
GenBank | CT836589 | 1e-153 | CT836589.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCFA333Z79, full insert sequence. |