 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
BGIOSGA023865-PA |
| Common Name | OsI_26970 |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
|
| Family |
MYB |
| Protein Properties |
Length: 152aa MW: 17311.6 Da PI: 7.3841 |
| Description |
MYB family protein |
| Gene Model |
| Gene Model ID |
Type |
Source |
Coding Sequence |
| BGIOSGA023865-PA | genome | RIS | View CDS |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | Myb_DNA-binding | 57.7 | 2.8e-18 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+WT+eEd+ lv +v+++G+g+W++++ + g+ R+ k+c++rw +yl
BGIOSGA023865-PA 14 KGPWTPEEDLVLVSYVQEHGPGNWRAVPTRTGLMRCSKSCRLRWTNYL 61
79********************************************97 PP
|
| 2 | Myb_DNA-binding | 53 | 7.6e-17 | 67 | 112 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
rg++T +E++l+v++ ++lG++ W++Ia++++ Rt++++k++w+++l
BGIOSGA023865-PA 67 RGNFTDQEEKLIVHLQALLGNR-WAAIASYLP-ERTDNDIKNYWNTHL 112
89********************.*********.************996 PP
|
| Sequence ? help Back to Top |
| Protein Sequence Length: 152 aa
Download sequence Send
to blast |
MVRPPCCDKD GVKKGPWTPE EDLVLVSYVQ EHGPGNWRAV PTRTGLMRCS KSCRLRWTNY 60
LRPGIKRGNF TDQEEKLIVH LQALLGNRWA AIASYLPERT DNDIKNYWNT HLKRKLQGGD 120
ETQLSAIESW LFADADGIES GSLLDAAMDY TF
|
| 3D Structure ? help Back to Top |
 |
| PDB ID |
Evalue |
Query Start |
Query End |
Hit Start |
Hit End |
Description |
| 1gv2_A | 4e-28 | 14 | 116 | 4 | 105 | MYB PROTO-ONCOGENE PROTEIN |
| 1h88_C | 2e-27 | 14 | 116 | 58 | 159 | MYB PROTO-ONCOGENE PROTEIN |
| 1h89_C | 2e-27 | 14 | 116 | 58 | 159 | MYB PROTO-ONCOGENE PROTEIN |
| 1h8a_C | 1e-27 | 12 | 116 | 25 | 128 | MYB TRANSFORMING PROTEIN |
| 1mse_C | 4e-28 | 14 | 116 | 4 | 105 | C-Myb DNA-Binding Domain |
| 1msf_C | 4e-28 | 14 | 116 | 4 | 105 | C-Myb DNA-Binding Domain |
| Search in ModeBase |
| Expression --
Description ? help
Back to Top |
| Source |
Description |
| Uniprot | DEVELOPMENTAL STAGE: Expressed in 2-week-old seedlings, in the early stages of development. {ECO:0000269|PubMed:10571865}. |
| Uniprot | TISSUE SPECIFICITY: Expressed in vascular tissues of leaves, hypocotyl and roots. {ECO:0000269|PubMed:24587042}. |
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Transcription factor that binds specifically to the DNA sequence 5'-AACAAAC-3' (PubMed:19170933). Acts as a positive regulator of hypersensitive cell death (PubMed:10571865, PubMed:12119395). Acts as a positive regulator of salicylic acid synthesis (PubMed:16730712). Regulates very-long-chain fatty acid biosynthesis (PubMed:18326828). Acts cooperatively with BZR2 to promote expression of a subset of brassinosteroids target genes (PubMed:19170933). Transcriptional activity and hypersensitive response control negatively regulated by PLA2-ALPHA and by the Xanthomonas type III effector XopD (AC G9L9K6) (PubMed:20696912, PubMed:21917550). Involved in the regulation of abscisic acid (ABA) signaling (PubMed:22814374). Increased levels of MYB30 can accelerate flowering both in long and short days through the regulation of FT (PubMed:24587042). {ECO:0000269|PubMed:10571865, ECO:0000269|PubMed:12119395, ECO:0000269|PubMed:16730712, ECO:0000269|PubMed:18326828, ECO:0000269|PubMed:19170933, ECO:0000269|PubMed:20696912, ECO:0000269|PubMed:21917550, ECO:0000269|PubMed:22814374, ECO:0000269|PubMed:24587042}. |
| Regulation -- Description ? help
Back to Top |
| Source |
Description |
| UniProt | INDUCTION: Up-regulated during hypersensitive response, but no expression detected during compatible interaction with pathogens (PubMed:10571865). Specifically induced in the inoculated zone 4 hours post pathogen infection (PubMed:20696912). Up-regulated by jasmonic acid and salicylic acid (PubMed:16463103, PubMed:16730712). Transcriptionally regulated by BZR2 (PubMed:19170933). {ECO:0000269|PubMed:10571865, ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:16730712, ECO:0000269|PubMed:19170933, ECO:0000269|PubMed:20696912}. |
| Annotation --
Nucleotide ? help
Back to Top |
| Source |
Hit ID |
E-value |
Description |
| GenBank | AK101674 | 0.0 | AK101674.1 Oryza sativa Japonica Group cDNA clone:J033058E05, full insert sequence. |
| Publications
? help Back to Top |
- Ding Y, et al.
Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
BMC Plant Biol., 2013. 13: p. 229
[PMID:24377444] - Kaurilind E,Xu E,Brosché M
A genetic framework for H2O2 induced cell death in Arabidopsis thaliana.
BMC Genomics, 2015. 16: p. 837
[PMID:26493993] - Lee HG,Seo PJ
The Arabidopsis MIEL1 E3 ligase negatively regulates ABA signalling by promoting protein turnover of MYB96.
Nat Commun, 2016. 7: p. 12525
[PMID:27615387] - Serrano I, et al.
A non canonical subtilase attenuates the transcriptional activation of defence responses in Arabidopsis thaliana.
Elife, 2017.
[PMID:27685353] - Liao C,Zheng Y,Guo Y
MYB30 transcription factor regulates oxidative and heat stress responses through ANNEXIN-mediated cytosolic calcium signaling in Arabidopsis.
New Phytol., 2017. 216(1): p. 163-177
[PMID:28726305] - Lee HG,Kim J,Suh MC,Seo PJ
The MIEL1 E3 Ubiquitin Ligase Negatively Regulates Cuticular Wax Biosynthesis in Arabidopsis Stems.
Plant Cell Physiol., 2017. 58(7): p. 1249-1259
[PMID:28838126] - Mabuchi K, et al.
MYB30 links ROS signaling, root cell elongation, and plant immune responses.
Proc. Natl. Acad. Sci. U.S.A., 2018. 115(20): p. E4710-E4719
[PMID:29712840] - Zheng Y,Chen Z,Ma L,Liao C
The Ubiquitin E3 Ligase RHA2b Promotes Degradation of MYB30 in Abscisic Acid Signaling.
Plant Physiol., 2018. 178(1): p. 428-440
[PMID:30030326]
|
