PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa

Family

GRAS

Protein Properties

Length: 88aa MW: 9347.56 Da PI: 4.5722

Description

GRAS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
BGIOSGA022538-PA	genome	RIS	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	GRAS	47.1	4e-15	3	56	165	219
GRAS 165 LakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvs 219 L+k Ae+l+vpf+fn+ v++rl++l++e+Lrvk+gEala++++lqlh ll+++ + BGIOSGA022538-PA 3 LTKEAERLDVPFQFNP-VVSRLDALDVESLRVKTGEALAICFSLQLHCLLASDDD 56 99************.7*****************************976654 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50985	9.591	1	88	IPR005202	Transcription factor GRAS
Pfam	PF03514	1.4E-12	3	56	IPR005202	Transcription factor GRAS

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated

Sequence ? help Back to Top
Protein Sequence Length: 88 aa Download sequence Send to blast
MALTKEAERL DVPFQFNPVV SRLDALDVES LRVKTGEALA ICFSLQLHCL LASDDDATAG 60 AGGDKERRSP ESGLSPSKSR ADAFLGAL

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Os.58982	1e-116	callus\| flower\| leaf\| root\| stem

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in seedlings, root epidermis, leaves, flowers and siliques. {ECO:0000269\|PubMed:10341448, ECO:0000269\|PubMed:18500650}.

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in plant development. {ECO:0000250}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AP003458	1e-147	AP003458.4 Oryza sativa Japonica Group genomic DNA, chromosome 6, PAC clone:P0701E03.
GenBank	AP004687	1e-147	AP004687.2 Oryza sativa Japonica Group genomic DNA, chromosome 6, PAC clone:P0021C04.
GenBank	AP014962	1e-147	AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015690954.1	1e-49	PREDICTED: scarecrow-like protein 3
Swissprot	Q9LPR8	2e-20	SCL3_ARATH; Scarecrow-like protein 3
TrEMBL	A0A0E0GNT9	1e-55	A0A0E0GNT9_ORYNI; Uncharacterized protein
TrEMBL	A2YAK9	1e-55	A2YAK9_ORYSI; Uncharacterized protein
TrEMBL	A3B9K4	1e-55	A3B9K4_ORYSJ; Uncharacterized protein
STRING	ONIVA03G22460.1	2e-56	(Oryza nivara)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP604	38	176

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G50420.1	3e-19	scarecrow-like 3

Publications ? help Back to Top
Gong X, et al. SEUSS Integrates Gibberellin Signaling with Transcriptional Inputs from the SHR-SCR-SCL3 Module to Regulate Middle Cortex Formation in the Arabidopsis Root. Plant Physiol., 2016. 170(3): p. 1675-83 [PMID:26818732] Lee SA, et al. Interplay between ABA and GA Modulates the Timing of Asymmetric Cell Divisions in the Arabidopsis Root Ground Tissue. Mol Plant, 2016. 9(6): p. 870-84 [PMID:26970019] Choi JW,Lim J Control of Asymmetric Cell Divisions during Root Ground Tissue Maturation. Mol. Cells, 2016. 39(7): p. 524-9 [PMID:27306644]