PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis

Family

WRKY

Protein Properties

Length: 62aa MW: 7522.41 Da PI: 8.9956

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Araip.PW834	genome	NCGR_PGC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	63.5	3.7e-20	7	45	20	58
S-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS WRKY 20 fprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 prsYYrCt+++C+vkk+ver +ed ++v++tYeg+Hnh Araip.PW834 7 EPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNH 45 7************************************** PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00774	3.4E-10	6	47	IPR003657	WRKY domain
Gene3D	G3DSA:2.20.25.80	3.6E-17	6	45	IPR003657	WRKY domain
SuperFamily	SSF118290	1.23E-15	7	45	IPR003657	WRKY domain
Pfam	PF03106	3.2E-14	7	45	IPR003657	WRKY domain
PROSITE profile	PS50811	17.557	8	45	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 62 aa Download sequence Send to blast
MRRKLREPRS YYRCTHSNCR VKKRVERLSE DCRMVITTYE GRHNHIPSDD SNSSDHECFT 60 SF

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Araip.PW834

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_025696497.1	2e-34	probable WRKY transcription factor 12
Swissprot	Q93WY4	7e-31	WRK12_ARATH; Probable WRKY transcription factor 12
TrEMBL	A0A445DC89	6e-33	A0A445DC89_ARAHY; Uncharacterized protein
STRING	XP_004306977.1	5e-32	(Fragaria vesca)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF7294	32	45

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G44745.1	3e-33	WRKY family protein

Publications ? help Back to Top
Yu Y, et al. MlWRKY12, a novel Miscanthus transcription factor, participates in pith secondary cell wall formation and promotes flowering. Plant Sci., 2013. 212: p. 1-9 [PMID:24094048] Yang L, et al. PtrWRKY19, a novel WRKY transcription factor, contributes to the regulation of pith secondary wall formation in Populus trichocarpa. Sci Rep, 2016. 6: p. 18643 [PMID:26819184] Li W,Wang H,Yu D Arabidopsis WRKY Transcription Factors WRKY12 and WRKY13 Oppositely Regulate Flowering under Short-Day Conditions. Mol Plant, 2016. 9(11): p. 1492-1503 [PMID:27592586] Han Y, et al. WRKY12 represses GSH1 expression to negatively regulate cadmium tolerance in Arabidopsis. Plant Mol. Biol., 2019. 99(1-2): p. 149-159 [PMID:30617455]