PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.F234U
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family M-type_MADS
Protein Properties Length: 61aa    MW: 7082.24 Da    PI: 10.4603
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.F234UgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF104.53.6e-33959151
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyeys+
  Araip.F234U  9 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSN 59
                 79***********************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.3E-42160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006634.048161IPR002100Transcription factor, MADS-box
SuperFamilySSF554559.03E-31260IPR002100Transcription factor, MADS-box
CDDcd002655.84E-39260No hitNo description
PRINTSPR004044.6E-34323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003193.6E-281057IPR002100Transcription factor, MADS-box
PRINTSPR004044.6E-342338IPR002100Transcription factor, MADS-box
PRINTSPR004044.6E-343859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 61 aa     Download sequence    Send to blast
MGRGKIEIKR IENTTNRQVT FCKRRNGLLK KAYELSVLCD AEVALIVFSS RGRLYEYSNN  60
K
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P8e-22160160Myocyte-specific enhancer factor 2B
1tqe_Q8e-22160160Myocyte-specific enhancer factor 2B
1tqe_R8e-22160160Myocyte-specific enhancer factor 2B
1tqe_S8e-22160160Myocyte-specific enhancer factor 2B
6c9l_A8e-22160160Myocyte-specific enhancer factor 2B
6c9l_B8e-22160160Myocyte-specific enhancer factor 2B
6c9l_C8e-22160160Myocyte-specific enhancer factor 2B
6c9l_D8e-22160160Myocyte-specific enhancer factor 2B
6c9l_E8e-22160160Myocyte-specific enhancer factor 2B
6c9l_F8e-22160160Myocyte-specific enhancer factor 2B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the development of floral organs. Acts as C-class protein in association with MADS58. Involved in the control of lodicule number (whorl 2), stamen specification (whorl 3) and floral meristem determinacy (whorl 4), but not in the regulation of carpel morphogenesis. Plays a more predominant role in controlling lodicule development and in specifying stamen identity than MADS58. {ECO:0000269|PubMed:11828031, ECO:0000269|PubMed:16326928, ECO:0000269|PubMed:9869408}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraip.F234U
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT7605814e-54KT760581.1 Thermopsis turcica agamous-like MADS-box protein SEEDSTICK mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007146364.16e-37hypothetical protein PHAVU_006G034400g
RefseqXP_018674452.17e-37PREDICTED: agamous-like MADS-box protein AGL11 isoform X1
SwissprotQ407044e-37MADS3_ORYSJ; MADS-box transcription factor 3
TrEMBLA0A426XLP84e-36A0A426XLP8_ENSVE; Uncharacterized protein
STRINGOS01T0201700-011e-36(Oryza sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11933360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.11e-38MIKC_MADS family protein
Publications ? help Back to Top
  1. Kyozuka J,Shimamoto K
    Ectopic expression of OsMADS3, a rice ortholog of AGAMOUS, caused a homeotic transformation of lodicules to stamens in transgenic rice plants.
    Plant Cell Physiol., 2002. 43(1): p. 130-5
    [PMID:11828031]
  2. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]