![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Araip.4Y3P3 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 196aa MW: 22457.3 Da PI: 9.2137 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 58.4 | 1.7e-18 | 19 | 66 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT+eEd++l++ ++ +G ++Wkt a + g++R++k+c++rw++yl Araip.4Y3P3 19 RGAWTPEEDDKLARFIEIHGAKRWKTLAVKSGLKRCGKSCRLRWLNYL 66 89********************************************97 PP | |||||||
2 | Myb_DNA-binding | 53.3 | 6.3e-17 | 72 | 117 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+ T eE++l+++++k+lG++ W++Ia +++ gRt++++k++w+++l Araip.4Y3P3 72 RGNITIEEEDLILRLHKLLGNR-WSLIAGRLP-GRTDNEIKNHWNSHL 117 789999****************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 14.982 | 14 | 66 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.35E-29 | 18 | 113 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.4E-14 | 18 | 68 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.6E-16 | 19 | 66 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.5E-23 | 20 | 73 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 8.19E-11 | 21 | 66 | No hit | No description |
PROSITE profile | PS51294 | 25.76 | 67 | 121 | IPR017930 | Myb domain |
SMART | SM00717 | 7.8E-13 | 71 | 119 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 5.0E-15 | 72 | 117 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 6.0E-25 | 74 | 121 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.27E-10 | 78 | 117 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009957 | Biological Process | epidermal cell fate specification | ||||
GO:0010090 | Biological Process | trichome morphogenesis | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0048481 | Biological Process | plant ovule development | ||||
GO:0048629 | Biological Process | trichome patterning | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 196 aa Download sequence Send to blast |
MAPKNNKKST KISSVMMNRG AWTPEEDDKL ARFIEIHGAK RWKTLAVKSG LKRCGKSCRL 60 RWLNYLRPNI KRGNITIEEE DLILRLHKLL GNRWSLIAGR LPGRTDNEIK NHWNSHLCKK 120 VNPNAGEPST STAKESGATL NNMEDSKIML EHNRATNNGS DENLDINFDV NEFFDFSTEG 180 SFGFDWANKY LEFDES |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1mse_C | 1e-29 | 16 | 121 | 1 | 105 | C-Myb DNA-Binding Domain |
1msf_C | 1e-29 | 16 | 121 | 1 | 105 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator, when associated with BHLH002/EGL3/MYC146, BHLH012/MYC1 or BHLH042/TT8. {ECO:0000269|PubMed:15361138}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Araip.4Y3P3 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016175211.1 | 1e-143 | transcription repressor MYB5-like | ||||
Refseq | XP_025631033.1 | 1e-143 | transcription repressor MYB5 | ||||
Swissprot | Q38850 | 1e-51 | MYB5_ARATH; Transcription repressor MYB5 | ||||
TrEMBL | A0A445AS82 | 1e-142 | A0A445AS82_ARAHY; Uncharacterized protein | ||||
STRING | XP_004508935.1 | 1e-87 | (Cicer arietinum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF2148 | 32 | 88 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G13540.1 | 5e-54 | myb domain protein 5 |
Publications ? help Back to Top | |||
---|---|---|---|
|