PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Araha.6226s0002.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 291aa MW: 34072.5 Da PI: 6.44 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 79.6 | 2.2e-25 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+ien++ rqvtfskRr+g++KK ELS+LCda + +i+fs tgkl e++s Araha.6226s0002.1.p 9 KKIENQTARQVTFSKRRTGLMKKTRELSILCDAHIGLIVFSATGKLSEFCS 59 68***********************************************96 PP | |||||||
2 | K-box | 53.1 | 1.4e-18 | 82 | 156 | 10 | 84 |
K-box 10 eeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkke 84 ++ ++e+l++e++ L++e+ nL+ +R + G dL s+ eL Le+qLe+s+ k+R++Knel+ +q+e+l +k Araha.6226s0002.1.p 82 HQDDQEQLYHEMELLRRETCNLELRLRPYHGHDLASIPPHELDGLERQLEHSVLKVRERKNELMQQQLENLSRKV 156 4567899****************************************************************9996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 2.1E-38 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 30.025 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 3.27E-31 | 2 | 92 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 2.58E-42 | 2 | 79 | No hit | No description |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.8E-26 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.1E-23 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.8E-26 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.8E-26 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 1.9E-16 | 82 | 156 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 13.416 | 86 | 212 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0008360 | Biological Process | regulation of cell shape | ||||
GO:0048316 | Biological Process | seed development | ||||
GO:0048481 | Biological Process | plant ovule development | ||||
GO:0080155 | Biological Process | regulation of double fertilization forming a zygote and endosperm | ||||
GO:2000029 | Biological Process | regulation of proanthocyanidin biosynthetic process | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 291 aa Download sequence Send to blast |
MGRGKIEIKK IENQTARQVT FSKRRTGLMK KTRELSILCD AHIGLIVFSA TGKLSEFCSE 60 QNRMPQLIDR YLHTNGLRLP DHQDDQEQLY HEMELLRRET CNLELRLRPY HGHDLASIPP 120 HELDGLERQL EHSVLKVRER KNELMQQQLE NLSRKVTLSN HPFLTLISSD NLINYTAGLM 180 IITMSIYAYN QRRMLEEDNN NMYRWLHEHR AAIEFQQAGI ETKPGEYQQF LEQLQYYKPG 240 EYDQQFLEQQ QQQQPNSVLQ LATLPSEIDP NYNLQLAQPN LQNDPTAKSD * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 9e-16 | 1 | 75 | 1 | 73 | MEF2C |
5f28_B | 9e-16 | 1 | 75 | 1 | 73 | MEF2C |
5f28_C | 9e-16 | 1 | 75 | 1 | 73 | MEF2C |
5f28_D | 9e-16 | 1 | 75 | 1 | 73 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in the developmental regulation of the endothelium and in the accumulation of proanthocyanidins (PAs) or condensed tannins which give the seed its brown pigmentation after oxidation (PubMed:12368498, PubMed:16080001). Necessary for the normal activation of the BANYULS promoter in the endothelium body (PubMed:12368498). Is required, together with AGL11/STK for the maternal control of endothelium formation, which is essential for female gametophyte development and fertilization, and seed formation (PubMed:22176531). Interacts genetically with AGL1/SHP1 and AGL5/SHP2 in a partially antagonistic manner and represses AGL1/SHP1, AGL5/SHP2, and AGL8/FUL during flower development. Is essential for the coordination of cell divisions in ovule, seed coat development and endosperm formation (PubMed:27776173). Mediates the crosstalk between endothelium and nucellus to ensure proper seed formation. Functions redundantly with AGL63/GOA to repress nucellus growth and promote its degeneration. Represses the negative regulator of autophagy and programmed cell death HVA22D in the proximal nucellus (PubMed:27233529). Binds specifically to the CArG box DNA sequence 5'-CC (A/T)6 GG-3' (PubMed:16080001). {ECO:0000269|PubMed:12368498, ECO:0000269|PubMed:16080001, ECO:0000269|PubMed:22176531, ECO:0000269|PubMed:27233529, ECO:0000269|PubMed:27776173}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Araha.6226s0002.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AJ318098 | 0.0 | AJ318098.1 Arabidopsis thaliana mRNA for putative MADS-domain transcription factor (abs gene). |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020876103.1 | 1e-169 | protein TRANSPARENT TESTA 16 isoform X1 | ||||
Swissprot | Q8RYD9 | 1e-162 | TT16_ARATH; Protein TRANSPARENT TESTA 16 | ||||
TrEMBL | D7M1P7 | 1e-167 | D7M1P7_ARALL; Uncharacterized protein | ||||
STRING | fgenesh2_kg.6__2319__AT5G23260.2 | 1e-168 | (Arabidopsis lyrata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM6506 | 25 | 43 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G23260.2 | 1e-147 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Araha.6226s0002.1.p |