![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Araha.30828s0011.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 197aa MW: 22072.3 Da PI: 5.4844 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 68 | 9e-22 | 9 | 56 | 1 | 48 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48 krienks rqvtfskRrng++ KA LS+LC+ vav+++s +gkly+ Araha.30828s0011.1.p 9 KRIENKSSRQVTFSKRRNGLIDKARQLSILCESSVAVVVVSASGKLYD 56 79********************************************97 PP | |||||||
2 | K-box | 35.4 | 4.4e-13 | 95 | 164 | 29 | 98 |
K-box 29 enLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 e L++ q +l ++++ s+ L +Le+qLe++l+ R++K el++e ++ l++ke l+een+ L +++ Araha.30828s0011.1.p 95 ELLETVQSKLEEPSVDNVSVDSLISLEEQLETALSVSRARKAELMMEYVKSLKEKEMLLREENQVLASQM 164 66777777788889999************************************************99876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF55455 | 1.44E-25 | 1 | 73 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 28.202 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 4.7E-33 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.0E-23 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.1E-21 | 10 | 55 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.0E-23 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.0E-23 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 11.333 | 80 | 170 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 1.5E-10 | 95 | 164 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009910 | Biological Process | negative regulation of flower development | ||||
GO:0048573 | Biological Process | photoperiodism, flowering | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 197 aa Download sequence Send to blast |
MGRRKIEIKR IENKSSRQVT FSKRRNGLID KARQLSILCE SSVAVVVVSA SGKLYDSSSG 60 DDISKIIDRY EIQHADELKA LDLAEKIQNY LPHKELLETV QSKLEEPSVD NVSVDSLISL 120 EEQLETALSV SRARKAELMM EYVKSLKEKE MLLREENQVL ASQMGKNTLL AIEDERGMLP 180 ESSSGNKIPE TLPLLK* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6bz1_A | 3e-15 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
6bz1_B | 3e-15 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
6bz1_C | 3e-15 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
6bz1_D | 3e-15 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in the negative regulation of flowering time in both long and short days, probably through the photoperiodic and vernalization pathways. Prevents premature flowering. {ECO:0000269|PubMed:11351076, ECO:0000269|PubMed:14558654, ECO:0000269|PubMed:15695584, ECO:0000269|PubMed:18799658}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00105 | ChIP-seq | Transfer from AT1G77080 | Download |
![]() |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Araha.30828s0011.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Slightly repressed by vernalization. Negatively regulated at the chromatin level by VIL1 through the photoperiod and vernalization pathways. Requires EARLY FLOWERING 7 (ELF7) and ELF8 to be expressed. Up-regulated by HUA2. {ECO:0000269|PubMed:11351076, ECO:0000269|PubMed:15520273, ECO:0000269|PubMed:15659097, ECO:0000269|PubMed:17114575}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF342808 | 0.0 | AF342808.1 Arabidopsis thaliana MADS affecting flowering 1 (MAF1) mRNA, complete cds. | |||
GenBank | AK117577 | 0.0 | AK117577.1 Arabidopsis thaliana mRNA for (NM_148660) MADS affecting flowering 1(MAF1); protein id: At1g77080.4, supported by cDNA: 92459., supported by cDNA: gi_13649968, supported by cDNA: gi_16580104 [Arabidopsis thaliana] gb|AAK37527.1|AF342808_1 (AF342808) MADS affecting flowering 1 [Arabidopsis thaliana] gb|AAK54440.1| (AY034083) MADS box FLC1-like nuclear protein [Arabidopsis thaliana] gb|AAM67028.1| (AY088709) MADS affecting flowering 1 [Arabidopsis thaliana], complete cds, clone: RAFL17-22-J12. | |||
GenBank | AK175247 | 0.0 | AK175247.1 Arabidopsis thaliana mRNA, complete cds, clone: RAFL21-67-N06. | |||
GenBank | AK176270 | 0.0 | AK176270.1 Arabidopsis thaliana mRNA, complete cds, clone: RAFL23-17-J21. | |||
GenBank | AK227948 | 0.0 | AK227948.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL14-50-E05. | |||
GenBank | AY034083 | 0.0 | AY034083.1 Arabidopsis thaliana MADS box FLC1-like nuclear protein (FK1) mRNA, complete cds. | |||
GenBank | AY088709 | 0.0 | AY088709.1 Arabidopsis thaliana clone 92459 mRNA, complete sequence. | |||
GenBank | BT004598 | 0.0 | BT004598.1 Arabidopsis thaliana At1g77080 gene, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020890340.1 | 1e-125 | agamous-like MADS-box protein AGL27 isoform X1 | ||||
Swissprot | Q9AT76 | 1e-122 | AGL27_ARATH; Agamous-like MADS-box protein AGL27 | ||||
TrEMBL | A0A1P8ARA3 | 1e-113 | A0A1P8ARA3_ARATH; K-box region and MADS-box transcription factor family protein | ||||
STRING | AT1G77080.4 | 1e-120 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM986 | 19 | 87 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G77080.4 | 1e-111 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Araha.30828s0011.1.p |