 |
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
Aradu.S93F6 |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
|
Family |
BES1 |
Protein Properties |
Length: 95aa MW: 11021.9 Da PI: 11.0178 |
Description |
BES1 family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
Aradu.S93F6 | genome | NCGR_PGC | View CDS |
|
Signature Domain? help Back to Top |
 |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | DUF822 | 162.6 | 2.5e-50 | 2 | 75 | 1 | 74 |
DUF822 1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgsk 74
++++r ptwkErEnnkrRERrRRaiaaki+aGLR++Gn+klpk++DnneVlkALc+eAGw+ve+DGttyrk ++
Aradu.S93F6 2 TSGTRLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNFKLPKHCDNNEVLKALCNEAGWTVEPDGTTYRKVTN 75
5899******************************************************************9876 PP
|
3D Structure ? help Back to Top |
 |
PDB ID |
Evalue |
Query Start |
Query End |
Hit Start |
Hit End |
Description |
5zd4_A | 2e-21 | 6 | 72 | 372 | 438 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
5zd4_B | 2e-21 | 6 | 72 | 372 | 438 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
5zd4_C | 2e-21 | 6 | 72 | 372 | 438 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
5zd4_D | 2e-21 | 6 | 72 | 372 | 438 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
Search in ModeBase |
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | May function in brassinosteroid signaling. {ECO:0000250}. |