PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Aradu.S2L37 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
|
||||||||
Family | HSF | ||||||||
Protein Properties | Length: 85aa MW: 9509.83 Da PI: 4.9341 | ||||||||
Description | HSF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HSF_DNA-bind | 29.2 | 2.4e-09 | 54 | 84 | 2 | 32 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES- CS HSF_DNA-bind 2 Flkklyeiledeelkeliswsengnsfvvld 32 Fl+k+y+i+ed+++++++ ws+ +nsfvv+d Aradu.S2L37 54 FLTKTYDIVEDPSTNHIVFWSKGNNSFVVWD 84 9*****************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.10 | 2.0E-10 | 47 | 85 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SuperFamily | SSF46785 | 1.63E-8 | 50 | 85 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
Pfam | PF00447 | 6.9E-6 | 54 | 85 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 85 aa Download sequence Send to blast |
MNPVDHGVGK VMKKEYLGEG YCSFSYPMVV DIPPPPLPPP HPMEGLNESG HPPFLTKTYD 60 IVEDPSTNHI VFWSKGNNSF VVWDP |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE). |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Aradu.S2L37 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015941402.1 | 1e-40 | heat stress transcription factor A-6b-like | ||||
Refseq | XP_025620243.1 | 1e-40 | heat stress transcription factor A-6b-like | ||||
Swissprot | Q9LUH8 | 8e-22 | HFA6B_ARATH; Heat stress transcription factor A-6b | ||||
TrEMBL | A0A0L9TZP4 | 1e-23 | A0A0L9TZP4_PHAAN; Uncharacterized protein | ||||
TrEMBL | A0A0S3SMT1 | 1e-23 | A0A0S3SMT1_PHAAN; Uncharacterized protein | ||||
STRING | GLYMA10G38930.2 | 1e-23 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1592 | 33 | 95 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G22830.1 | 9e-21 | heat shock transcription factor A6B |