PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis

Family

MYB_related

Protein Properties

Length: 97aa MW: 11276 Da PI: 9.7216

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Aradu.RDF0H	genome	NCGR_PGC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	52.9	8.6e-17	15	62	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g W++eEde+l+++ G g+W+ Iar g+ R++k+c++rw +yl Aradu.RDF0H 15 KGLWSPEEDEKLIRYMITKGEGCWSDIARNAGLERCGKSCRLRWINYL 62 678*******************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	23.123	10	66	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	3.4E-23	11	65	IPR009057	Homeodomain-like
SMART	SM00717	1.8E-13	14	64	IPR001005	SANT/Myb domain
Pfam	PF00249	3.5E-15	15	62	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	1.59E-21	17	90	IPR009057	Homeodomain-like
CDD	cd00167	1.06E-10	18	62	No hit	No description
Gene3D	G3DSA:1.10.10.60	2.8E-7	66	89	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 97 aa Download sequence Send to blast
MVKEKSKNNG SKQRKGLWSP EEDEKLIRYM ITKGEGCWSD IARNAGLERC GKSCRLRWIN 60 YLRPDLKRGA FSLQEEDLII HLHSILGNRC IFLSTHT

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	6e-14	15	94	27	105	MYB TRANSFORMING PROTEIN
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that acts as molecular switch in the NAC012/SND1-mediated transcriptional network regulating secondary wall biosynthesis. Is directly activated by NAC012/SND1 and its close homologs, including NAC043/NST1, NAC066/NST2, NAC101/VND6 and NAC030/VND7. Is required for functional expression of a number of secondary wall-associated transcription factors and secondary wall biosynthetic genes involved in cellulose, xylan and lignin synthesis. Functions redundantly with MYB46 in the transcriptional regulatory cascade leading to secondary wall formation in fibers and vessels (PubMed:19808805). Transcription activator that binds to the DNA consensus sequence 5'-ACC[AT]A[AC][TC]-3', designated as the secondary wall MYB-responsive element (SMRE). Regulates directly numerous transcription factors and a number of genes involved in secondary wall biosynthesis that contain SMRE elements in their promoters (PubMed:22197883). {ECO:0000269\|PubMed:19808805, ECO:0000269\|PubMed:22197883}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Aradu.RDF0H

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015936844.1	3e-59	transcription factor MYB21-like
Refseq	XP_025615019.1	4e-59	transcription factor MYB83-like
Swissprot	Q9C6U1	3e-46	MYB83_ARATH; Transcription factor MYB83
TrEMBL	A0A445BYZ4	3e-59	A0A445BYZ4_ARAHY; Uncharacterized protein
STRING	GLYMA13G07020.2	9e-48	(Glycine max)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF774	34	128

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G08500.1	1e-48	myb domain protein 83

Publications ? help Back to Top
Vargas L, et al. Improving total saccharification yield of Arabidopsis plants by vessel-specific complementation of caffeoyl shikimate esterase (cse) mutants. Biotechnol Biofuels, 2016. 9: p. 139 [PMID:27390589] Piya S,Kihm C,Rice JH,Baum TJ,Hewezi T Cooperative Regulatory Functions of miR858 and MYB83 during Cyst Nematode Parasitism. Plant Physiol., 2017. 174(3): p. 1897-1912 [PMID:28512179]