![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Aradu.QIF3G | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
|
||||||||
Family | FAR1 | ||||||||
Protein Properties | Length: 91aa MW: 10375.6 Da PI: 4.4189 | ||||||||
Description | FAR1 family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | FAR1 | 24.2 | 1.1e-07 | 51 | 88 | 1 | 40 |
FAR1 1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegk 40 kfY++YAk +GFs+r++++ ++ +ei+++ +Cs++ k Aradu.QIF3G 51 KFYKNYAKAAGFSTRVRSTIRK--GNEIKNQLITCSRKEK 88 6****************98887..8889********9865 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF03101 | 3.8E-5 | 51 | 88 | IPR004330 | FAR1 DNA binding domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 91 aa Download sequence Send to blast |
MDDSTSDCQL NQGEVDYEFE SNEVPEPLSV VDDQFVPKVG MTFTTLEDAE KFYKNYAKAA 60 GFSTRVRSTI RKGNEIKNQL ITCSRKEKIE I |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Aradu.QIF3G |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HQ637178 | 7e-69 | HQ637178.1 Arachis hypogaea clone AHF-205D04 NBS-LRR gene cluster, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020997266.1 | 4e-47 | protein FAR1-RELATED SEQUENCE 5-like | ||||
TrEMBL | A0A444YT88 | 2e-55 | A0A444YT88_ARAHY; Uncharacterized protein |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF21 | 14 | 477 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G28530.1 | 5e-07 | FAR1-related sequence 10 |