PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis

Family

SBP

Protein Properties

Length: 124aa MW: 14623.6 Da PI: 10.1367

Description

SBP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Aradu.NXM6F	genome	NCGR_PGC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SBP	126.4	1.1e-39	3	78	1	76
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 +Cq+e+C+adl+ea++yhrrh+vCe h+ka+vvlvsg++qrfCqqCsrfhe+ efD++krsCrrrLa+hn+rrrk+ Aradu.NXM6F 3 CCQAEKCKADLEEARQYHRRHRVCEYHAKAQVVLVSGIRQRFCQQCSRFHEIGEFDDTKRSCRRRLAGHNQRRRKN 78 6*************************************************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51141	31.325	1	78	IPR004333	Transcription factor, SBP-box
Gene3D	G3DSA:4.10.1100.10	3.6E-31	2	65	IPR004333	Transcription factor, SBP-box
SuperFamily	SSF103612	1.77E-36	2	81	IPR004333	Transcription factor, SBP-box
Pfam	PF03110	4.5E-32	4	77	IPR004333	Transcription factor, SBP-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 124 aa Download sequence Send to blast
MRCCQAEKCK ADLEEARQYH RRHRVCEYHA KAQVVLVSGI RQRFCQQCSR FHEIGEFDDT 60 KRSCRRRLAG HNQRRRKNCD SQAEGSRRKG ICPQLKKDTA CGDDRSRIQI AIQESGAYKH 120 FQIR

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ul4_A	1e-34	1	77	8	84	squamosa promoter binding protein-like 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Promotes both vegetative phase change and flowering. {ECO:0000269\|PubMed:10524240, ECO:0000269\|PubMed:16914499}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00634	PBM	Transfer from PK22320.1	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Aradu.NXM6F

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Negatively regulated by microRNAs miR156 and miR157. {ECO:0000305\|PubMed:12202040, ECO:0000305\|PubMed:16914499}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AP007305	4e-31	AP007305.2 Lotus japonicus genomic DNA, chromosome 3, clone: LjT29I08, TM1257, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015936261.1	1e-85	squamosa promoter-binding protein 1-like
Swissprot	Q9S7A9	2e-39	SPL4_ARATH; Squamosa promoter-binding-like protein 4
TrEMBL	A0A445BXE4	1e-83	A0A445BXE4_ARAHY; Uncharacterized protein
STRING	XP_010091480.1	6e-59	(Morus notabilis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF535	34	153

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G53160.2	9e-42	squamosa promoter binding protein-like 4

Publications ? help Back to Top
Jorgensen SA,Preston JC Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis. Mol. Phylogenet. Evol., 2014. 73: p. 129-39 [PMID:24508602] Hyun Y, et al. Site-directed mutagenesis in Arabidopsis thaliana using dividing tissue-targeted RGEN of the CRISPR/Cas system to generate heritable null alleles. Planta, 2015. 241(1): p. 271-84 [PMID:25269397] Xu M, et al. Developmental Functions of miR156-Regulated SQUAMOSA PROMOTER BINDING PROTEIN-LIKE (SPL) Genes in Arabidopsis thaliana. PLoS Genet., 2016. 12(8): p. e1006263 [PMID:27541584] Ioannidi E, et al. Trichome patterning control involves TTG1 interaction with SPL transcription factors. Plant Mol. Biol., 2016. 92(6): p. 675-687 [PMID:27631431] Jung JH,Lee HJ,Ryu JY,Park CM SPL3/4/5 Integrate Developmental Aging and Photoperiodic Signals into the FT-FD Module in Arabidopsis Flowering. Mol Plant, 2016. 9(12): p. 1647-1659 [PMID:27815142]