PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Aradu.8U1PN | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 88aa MW: 10021 Da PI: 4.5318 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 33.3 | 1.1e-10 | 33 | 73 | 2 | 44 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 + ++++E++l ++ +++ G++ W++Ia +++ gRt+ ++ +w Aradu.8U1PN 33 LEFSEDEEDLVARMFRLVGKR-WSLIAGRIP-GRTAQEIEKYW 73 579******************.*********.*********** PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00717 | 3.5E-6 | 31 | 79 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.5E-12 | 34 | 75 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 6.60E-8 | 34 | 73 | No hit | No description |
Pfam | PF00249 | 1.7E-9 | 34 | 73 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS50090 | 6.62 | 35 | 77 | IPR017877 | Myb-like domain |
SuperFamily | SSF46689 | 4.73E-8 | 35 | 75 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 88 aa Download sequence Send to blast |
MSDSNHHSTT EANTASSDQF VKEMRQEEEP TMLEFSEDEE DLVARMFRLV GKRWSLIAGR 60 IPGRTAQEIE KYWSSKCAFP SDQCSSSA |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MYB-type transcription factor involved in epidermal cell fate specification. Acts as a negative regulator of trichome development, including endoreplication, by mediating lateral inhibition. Promotes the formation of hair developing cells in H position in root epidermis, probably by inhibiting non-hair cell formation. May have pleiotropic effects on flowering development and epidermal cell size through the regulation of endoreduplication. {ECO:0000269|PubMed:18305006}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Aradu.8U1PN |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015958601.1 | 2e-60 | MYB-like transcription factor ETC3 | ||||
Refseq | XP_016196430.1 | 2e-60 | MYB-like transcription factor ETC3 | ||||
Refseq | XP_025645884.1 | 2e-60 | MYB-like transcription factor ETC3 | ||||
Refseq | XP_025693909.1 | 2e-60 | MYB-like transcription factor ETC3 | ||||
Swissprot | Q9M157 | 1e-16 | ETC3_ARATH; MYB-like transcription factor ETC3 | ||||
TrEMBL | A0A444ZCN5 | 5e-59 | A0A444ZCN5_ARAHY; Uncharacterized protein | ||||
STRING | XP_004486159.1 | 5e-25 | (Cicer arietinum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF2692 | 31 | 78 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G01060.3 | 5e-19 | CAPRICE-like MYB3 |