PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Aradu.0BJ82 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
|
||||||||
Family | NF-YC | ||||||||
Protein Properties | Length: 118aa MW: 13963.9 Da PI: 8.2545 | ||||||||
Description | NF-YC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YC | 98 | 7.2e-31 | 18 | 98 | 3 | 83 |
NF-YC 3 ksfwekqiekatdfknhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaav 83 sf +++e+a+dfkn +Plar++k++k++edv +isae+Pv+l+kac+lfi ++tl+sw +a++nkr+ ++++di++++ Aradu.0BJ82 18 WSFQRREVEQAHDFKNGLFPLARVRKMMKVEEDVDRISAEVPVVLAKACDLFIRNVTLQSWHQAQKNKRSIIQRQDINSTM 98 34455569*********************************************************************9876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF47113 | 6.54E-21 | 14 | 100 | IPR009072 | Histone-fold |
Gene3D | G3DSA:1.10.20.10 | 4.1E-25 | 27 | 96 | IPR009072 | Histone-fold |
Pfam | PF00808 | 8.9E-17 | 36 | 96 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 118 aa Download sequence Send to blast |
MGNQNSTQQH QIEIENLWSF QRREVEQAHD FKNGLFPLAR VRKMMKVEED VDRISAEVPV 60 VLAKACDLFI RNVTLQSWHQ AQKNKRSIIQ RQDINSTMDS FRDACHNIEY FKRLMSEA |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_B | 3e-23 | 21 | 98 | 3 | 80 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT C-3 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters (By similarity). Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000250, ECO:0000269|PubMed:17322342}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Aradu.0BJ82 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015937733.1 | 4e-84 | nuclear transcription factor Y subunit C-1-like | ||||
Swissprot | Q9FMV5 | 4e-26 | NFYC4_ARATH; Nuclear transcription factor Y subunit C-4 | ||||
TrEMBL | A0A445C211 | 3e-82 | A0A445C211_ARAHY; Uncharacterized protein | ||||
STRING | XP_006493208.1 | 2e-25 | (Citrus sinensis) | ||||
STRING | XP_006436849.1 | 2e-25 | (Citrus clementina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF23344 | 2 | 3 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G63470.2 | 2e-28 | nuclear factor Y, subunit C4 |