 |
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
Ahy022186 |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
|
Family |
Dof |
Protein Properties |
Length: 96aa MW: 10984.1 Da PI: 9.358 |
Description |
Dof family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
gnl|UG|Ahy#S56348394 | PU_ref | Unigene | View CDS |
|
Signature Domain? help Back to Top |
 |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | zf-Dof | 117.3 | 6.2e-37 | 13 | 70 | 2 | 59 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59
+e+ ++cprCds+ntkfCy+nnysls PryfCkaC+ryWt GG+lrn+PvGgg+r ++
Ahy022186 13 EEEGVNCPRCDSSNTKFCYFNNYSLSSPRYFCKACKRYWTIGGTLRNIPVGGGARARR 70
57899**************************************************876 PP
|
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Transcription factor specifically involved in the maternal control of seed germination. Regulates transcription by binding to a 5'-AA[AG]G-3' consensus core sequence. May ensure the inactivity of a component that would be activated to trigger germination as a consequence of red light perception. |