![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Aco024142.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 207aa MW: 23314.3 Da PI: 10.1399 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 50 | 6.5e-16 | 122 | 175 | 3 | 56 |
XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 +++r+rr++kNRe+A rsR+RK+a++ eLe v++Le+eN +L ke e k + Aco024142.1 122 AVRRQRRMIKNRESAARSRERKQAYTLELESLVAQLEEENARLLKEKEDFKRLR 175 689******************************************999888765 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PRINTS | PR00041 | 5.9E-6 | 119 | 135 | IPR001630 | cAMP response element binding (CREB) protein |
SMART | SM00338 | 1.0E-13 | 120 | 184 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 2.6E-14 | 121 | 173 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 11.404 | 122 | 173 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 5.98E-11 | 123 | 173 | No hit | No description |
CDD | cd14707 | 1.27E-19 | 124 | 173 | No hit | No description |
Gene3D | G3DSA:1.20.5.170 | 4.5E-14 | 124 | 173 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 127 | 142 | IPR004827 | Basic-leucine zipper domain |
PRINTS | PR00041 | 5.9E-6 | 137 | 157 | IPR001630 | cAMP response element binding (CREB) protein |
PRINTS | PR00041 | 5.9E-6 | 157 | 174 | IPR001630 | cAMP response element binding (CREB) protein |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 207 aa Download sequence Send to blast |
MASPAVDSDV ARPISPYPLS VEDLPASTSD RSQTLRSMGD LLRSIHGAGG GGVRGGDQDE 60 DEAYGEMTLE DFLARAGAVK KEEEDDARVL PENPVLGFGG EERRRRGRRR KRPVLDPIDN 120 AAVRRQRRMI KNRESAARSR ERKQAYTLEL ESLVAQLEEE NARLLKEKED FKRLRLKEIK 180 ENIIPLTEKK TPARPSPLRR TQSSKW* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 101 | 112 | ERRRRGRRRKRP |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds to the ABA-responsive elements (ABREs) in vitro. Involved in abiotic stress responses and abscisic acid (ABA) signaling (PubMed:20039193). Involved in the signaling pathway that induces growth inhibition in response to D-allose (PubMed:23397192). {ECO:0000269|PubMed:20039193, ECO:0000269|PubMed:23397192}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by anoxia, drought, salt stress, oxidative stress, cold and abscisic acid (ABA) (PubMed:20039193). Induced by D-allose (PubMed:23397192). {ECO:0000269|PubMed:20039193, ECO:0000269|PubMed:23397192}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KM662447 | 6e-99 | KM662447.1 Ananas bracteatus clone 46183 microsatellite sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020110098.1 | 1e-145 | G-box-binding factor 4-like | ||||
Swissprot | Q0JHF1 | 3e-41 | BZP12_ORYSJ; bZIP transcription factor 12 | ||||
TrEMBL | A0A199UNS9 | 3e-96 | A0A199UNS9_ANACO; G-box-binding factor 4 | ||||
STRING | GSMUA_Achr3P22470_001 | 3e-47 | (Musa acuminata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2665 | 37 | 86 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G44080.1 | 2e-27 | bZIP family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Aco024142.1 |
Publications ? help Back to Top | |||
---|---|---|---|
|