PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Achn369231 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 140aa MW: 15236.2 Da PI: 6.0955 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 49.6 | 8.1e-16 | 21 | 58 | 22 | 59 |
EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 22 rsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 +YYrCtsagCpv+k++er+ +++++++itY+g H+h+ Achn369231 21 WNYYRCTSAGCPVRKHIERDVDNTSALIITYKGIHDHD 58 57***********************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00774 | 2.7E-7 | 11 | 59 | IPR003657 | WRKY domain |
Pfam | PF03106 | 2.8E-10 | 20 | 57 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 7.19E-13 | 21 | 60 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 17.523 | 22 | 60 | IPR003657 | WRKY domain |
Gene3D | G3DSA:2.20.25.80 | 4.3E-14 | 22 | 60 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 140 aa Download sequence Send to blast |
MDKLMLECGT FTQYAACSKS WNYYRCTSAG CPVRKHIERD VDNTSALIIT YKGIHDHDMP 60 VPKKRHGPPS APLIAAAAPA SMNNSQLKKT DANQDQVSAT QWSVDTEGEL MGEAVEAGEE 120 KAMESARTLL SIGFEIKQC* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. {ECO:0000250|UniProtKB:Q9SI37}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007154886.1 | 6e-62 | hypothetical protein PHAVU_003G156300g | ||||
Swissprot | P59583 | 2e-46 | WRK32_ARATH; Probable WRKY transcription factor 32 | ||||
TrEMBL | A0A2R6QHL7 | 9e-62 | A0A2R6QHL7_ACTCH; WRKY transcription factor | ||||
TrEMBL | M1AS70 | 2e-62 | M1AS70_SOLTU; Uncharacterized protein | ||||
STRING | XP_007154886.1 | 2e-61 | (Phaseolus vulgaris) | ||||
STRING | PGSC0003DMT400029069 | 4e-63 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA9189 | 21 | 27 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G30935.1 | 2e-40 | WRKY DNA-binding protein 32 |