PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Achn296141 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 239aa MW: 27493.7 Da PI: 4.7937 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 58.4 | 2.5e-18 | 14 | 61 | 1 | 49 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk 49 + pGfrFhPtdeelv +yL++kve+k+l++ e i++vdiyk++Pw+Lp+ Achn296141 14 MLPGFRFHPTDEELVGFYLRRKVEKKSLTM-ELIQQVDIYKFDPWELPN 61 579*************************99.89**************94 PP | |||||||
2 | NAM | 36.4 | 1.6e-11 | 64 | 95 | 97 | 128 |
NAM 97 gelvglkktLvfykgrapkgektdWvmheyrl 128 g+++glkk+Lv+y+g+a kg+ktdW+mhe+rl Achn296141 64 GATIGLKKSLVYYRGSAGKGTKTDWMMHEFRL 95 6789**************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 2.09E-33 | 11 | 142 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 16.932 | 14 | 182 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.4E-15 | 16 | 95 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 239 aa Download sequence Send to blast |
MNISDSKSRD NDVMLPGFRF HPTDEELVGF YLRRKVEKKS LTMELIQQVD IYKFDPWELP 60 NGSGATIGLK KSLVYYRGSA GKGTKTDWMM HEFRLPPPTT TNNNLHITGT AARNISTDQE 120 AVRQFLVNGW QEVWTLCRIF KRNATYKMKK YIPHEEEEEE EEEEETATAA KQSSLESDIT 180 HEHERNEQLA VDQKKNIEAV PLTPPSPYSA LIWDHDFFRD GNWEDLTSVV ELAIDPSN* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 5e-24 | 1 | 145 | 4 | 168 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 5e-24 | 1 | 145 | 4 | 168 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 5e-24 | 1 | 145 | 4 | 168 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 5e-24 | 1 | 145 | 4 | 168 | NO APICAL MERISTEM PROTEIN |
3swm_A | 4e-24 | 1 | 145 | 7 | 171 | NAC domain-containing protein 19 |
3swm_B | 4e-24 | 1 | 145 | 7 | 171 | NAC domain-containing protein 19 |
3swm_C | 4e-24 | 1 | 145 | 7 | 171 | NAC domain-containing protein 19 |
3swm_D | 4e-24 | 1 | 145 | 7 | 171 | NAC domain-containing protein 19 |
3swp_A | 4e-24 | 1 | 145 | 7 | 171 | NAC domain-containing protein 19 |
3swp_B | 4e-24 | 1 | 145 | 7 | 171 | NAC domain-containing protein 19 |
3swp_C | 4e-24 | 1 | 145 | 7 | 171 | NAC domain-containing protein 19 |
3swp_D | 4e-24 | 1 | 145 | 7 | 171 | NAC domain-containing protein 19 |
4dul_A | 5e-24 | 1 | 145 | 4 | 168 | NAC domain-containing protein 19 |
4dul_B | 5e-24 | 1 | 145 | 4 | 168 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds to the 5'- RRYGCCGT-3' consensus core sequence. Central longevity regulator. Negative regulator of leaf senescence. Modulates cellular H(2)O(2) levels and enhances tolerance to various abiotic stresses through the regulation of DREB2A. {ECO:0000269|PubMed:22345491}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Up-regulated by H(2)O(2), paraquat, ozone, 3-aminotriazole and salt stress. {ECO:0000269|PubMed:22345491}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011016675.1 | 2e-60 | PREDICTED: transcription factor JUNGBRUNNEN 1-like isoform X1 | ||||
Swissprot | Q9SK55 | 1e-43 | NAC42_ARATH; Transcription factor JUNGBRUNNEN 1 | ||||
TrEMBL | A0A2R6QYZ5 | 1e-142 | A0A2R6QYZ5_ACTCH; Transcription factor JUNGBRUNNEN like | ||||
STRING | POPTR_0005s22710.1 | 3e-59 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA16497 | 4 | 5 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G43000.1 | 4e-46 | NAC domain containing protein 42 |