![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Achn259121 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 147aa MW: 16210.1 Da PI: 5.357 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 169 | 5.7e-53 | 16 | 108 | 2 | 94 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94 +eqdr+lPianv+rimk++lP nak+sk+aket+qecvsefisfvt+easdkc++ekrkt+ngdd++wal++lGf+dy++p+k+yl++yrel Achn259121 16 KEQDRLLPIANVGRIMKQILPPNAKVSKEAKETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDICWALGSLGFDDYAKPMKKYLNRYRELG 108 89*****************************************************************************************84 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.1E-51 | 11 | 126 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 6.29E-40 | 18 | 130 | IPR009072 | Histone-fold |
Pfam | PF00808 | 8.1E-28 | 21 | 85 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.8E-18 | 49 | 67 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 52 | 68 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.8E-18 | 68 | 86 | No hit | No description |
PRINTS | PR00615 | 1.8E-18 | 87 | 105 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 147 aa Download sequence Send to blast |
MVDNIGSNSS EDGVIKEQDR LLPIANVGRI MKQILPPNAK VSKEAKETMQ ECVSEFISFV 60 TGEASDKCHK EKRKTVNGDD ICWALGSLGF DDYAKPMKKY LNRYRELGER DSQNKASNGN 120 EDSKDEPPNY GGEPSTFKFS VINGGK* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 1e-44 | 15 | 106 | 1 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 1e-44 | 15 | 106 | 1 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010652046.1 | 2e-73 | PREDICTED: nuclear transcription factor Y subunit B-5 | ||||
Swissprot | O82248 | 1e-57 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | A0A2R6QDN4 | 1e-104 | A0A2R6QDN4_ACTCH; Nuclear transcription factor Y subunit B-5 like | ||||
STRING | VIT_07s0104g01640.t01 | 7e-73 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA111 | 24 | 356 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 6e-60 | nuclear factor Y, subunit B5 |
Publications ? help Back to Top | |||
---|---|---|---|
|