PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Achn248321 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 143aa MW: 16115.9 Da PI: 4.6099 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 123.4 | 9.1e-39 | 7 | 80 | 23 | 97 |
NF-YB 23 anakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 +++k s+d+ket+qecvsefisf+t+ea+d+cqre+rkti+++d+lwa+++lGf+dy+epl++yl++yre+eg++ Achn248321 7 KQSK-SDDSKETIQECVSEFISFITGEANDRCQREQRKTITAEDVLWAMSKLGFDDYIEPLNLYLSRYREFEGDR 80 4444.89******************************************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 4.6E-35 | 8 | 85 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 2.85E-27 | 9 | 83 | IPR009072 | Histone-fold |
Pfam | PF00808 | 3.8E-16 | 11 | 54 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.7E-17 | 18 | 36 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 21 | 37 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.7E-17 | 37 | 55 | No hit | No description |
PRINTS | PR00615 | 1.7E-17 | 56 | 74 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 143 aa Download sequence Send to blast |
MDKNVRKQSK SDDSKETIQE CVSEFISFIT GEANDRCQRE QRKTITAEDV LWAMSKLGFD 60 DYIEPLNLYL SRYREFEGDR GSIRSEPFVK RAVEFAPVFQ LGGHHNGFFG SAMGGFFLKD 120 MSNEGSSQAA VAGIEPYFQC DE* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_A | 5e-40 | 11 | 75 | 33 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. Plays a role in the regulation of the embryogenesis. Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003635503.1 | 9e-67 | PREDICTED: nuclear transcription factor Y subunit B-6 | ||||
Swissprot | Q84W66 | 4e-42 | NFYB6_ARATH; Nuclear transcription factor Y subunit B-6 | ||||
TrEMBL | A0A2R6PX98 | 8e-86 | A0A2R6PX98_ACTCH; Nuclear transcription factor Y subunit B-6 like | ||||
STRING | VIT_00s0956g00020.t01 | 4e-66 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA111 | 24 | 356 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G47670.2 | 9e-45 | nuclear factor Y, subunit B6 |