PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Achn244541 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 102aa MW: 11173.7 Da PI: 10.2645 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 61.5 | 1.5e-19 | 5 | 45 | 19 | 59 |
SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 19 efprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 rsYY+Ct agC+v+k+ver++ dpk v++tYeg+Hnh+ Achn244541 5 SICRSYYKCTNAGCNVRKQVERASADPKSVVTTYEGKHNHD 45 678*************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00774 | 3.1E-13 | 1 | 46 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 3.4E-15 | 5 | 47 | IPR003657 | WRKY domain |
Gene3D | G3DSA:2.20.25.80 | 3.2E-18 | 5 | 47 | IPR003657 | WRKY domain |
Pfam | PF03106 | 3.7E-14 | 6 | 45 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 22.114 | 8 | 47 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 102 aa Download sequence Send to blast |
MLLNSICRSY YKCTNAGCNV RKQVERASAD PKSVVTTYEG KHNHDVPAAR KSSQNTANSN 60 TSQVKSQKVV AKKPALLAEI GFRNNDQRPV LVQLKEEQIT A* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 6e-20 | 4 | 48 | 34 | 78 | Probable WRKY transcription factor 4 |
2lex_A | 6e-20 | 4 | 48 | 34 | 78 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By salicylic acid and during leaf senescence. {ECO:0000269|PubMed:11449049, ECO:0000269|PubMed:11722756}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_028091443.1 | 9e-45 | probable WRKY transcription factor 3 | ||||
Swissprot | Q9ZQ70 | 1e-21 | WRKY3_ARATH; Probable WRKY transcription factor 3 | ||||
TrEMBL | A0A2R6RUG1 | 5e-58 | A0A2R6RUG1_ACTCH; WRKY transcription factor 4 | ||||
STRING | POPTR_0017s12420.1 | 2e-43 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA17453 | 3 | 4 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G03340.1 | 4e-21 | WRKY DNA-binding protein 3 |
Publications ? help Back to Top | |||
---|---|---|---|
|