PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Achn229111

Organism

Actinidia chinensis

Taxonomic ID

3625

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia

Family

WRKY

Protein Properties

Length: 85aa MW: 9804.04 Da PI: 9.4003

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Achn229111	genome	IKGC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	100.6	9.5e-32	1	59	1	59
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 +dDg++WrKYG+K+vk+s++pr+YY+C+s gC+vkk+ver++edp++v++tY g Hnhe Achn229111 1 MDDGFKWRKYGKKMVKNSPNPRNYYKCSSGGCNVKKRVERDREDPSYVITTYDGVHNHE 59 69********************************************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	2.4E-30	1	61	IPR003657	WRKY domain
SMART	SM00774	3.5E-35	1	60	IPR003657	WRKY domain
SuperFamily	SSF118290	7.32E-27	1	61	IPR003657	WRKY domain
PROSITE profile	PS50811	30.389	1	61	IPR003657	WRKY domain
Pfam	PF03106	7.4E-25	2	59	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009867	Biological Process	jasmonic acid mediated signaling pathway
GO:0042742	Biological Process	defense response to bacterium
GO:0050832	Biological Process	defense response to fungus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 85 aa Download sequence Send to blast
MDDGFKWRKY GKKMVKNSPN PRNYYKCSSG GCNVKKRVER DREDPSYVIT TYDGVHNHES 60 PCVFYYNHTP LMVPNGWTLQ PSPS*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	6e-23	1	62	17	78	Probable WRKY transcription factor 4
2lex_A	6e-23	1	62	17	78	Probable WRKY transcription factor 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). Involved in defense responses. May act as positive regulator of salicylic acid (SA)-mediated signaling and negative regulator of jasmonic acid (JA)-mediated signaling (PubMed:21030507). {ECO:0000250, ECO:0000269\|PubMed:21030507}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_019053770.1	2e-50	PREDICTED: probable WRKY transcription factor 51 isoform X2
Refseq	XP_028125075.1	2e-50	probable WRKY transcription factor 51 isoform X2
Swissprot	Q93WU9	2e-32	WRK51_ARATH; Probable WRKY transcription factor 51
TrEMBL	A0A2R6RKB2	3e-57	A0A2R6RKB2_ACTCH; WRKY transcription factor 51
STRING	XP_010261070.1	4e-49	(Nelumbo nucifera)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA2124	24	62

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G64810.1	1e-34	WRKY DNA-binding protein 51

Publications ? help Back to Top
Yan C, et al. Injury Activates Ca2+/Calmodulin-Dependent Phosphorylation of JAV1-JAZ8-WRKY51 Complex for Jasmonate Biosynthesis. Mol. Cell, 2018. 70(1): p. 136-149.e7 [PMID:29625034]